|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 6)| Asymmetric/Biological Unit (2, 6) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3B73) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3B73) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3B73) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3B73) |
Exons (0, 0)| (no "Exon" information available for 3B73) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:88 aligned with Q5V043_HALMA | Q5V043 from UniProtKB/TrEMBL Length:108 Alignment length:88 1 | 8 18 28 38 48 58 68 78 Q5V043_HALMA - --MRQSGSWMTIWDDRILEIIHEEGNGSPKELEDRDEIRISKSSVSRRLKKLADHDLLQPLANGVYVITEEGEAYLNGEYDAGKERYI 86 SCOP domains ---------------------------------------------------------------------------------------- SCOP domains CATH domains 3b73A00 A:-1-86 'winged helix' repressor DNA binding domain CATH domains Pfam domains ---------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------- Transcript 3b73 A -1 NAmRQSGSWmTIWDDRILEIIHEEGNGSPKELEDRDEIRISKSSVSRRLKKLADHDLLQPLANGVYVITEEGEAYLNGEYDAGKERYI 86 | 8 18 28 38 48 58 68 78 | 8-MSE 1-MSE Chain B from PDB Type:PROTEIN Length:89 aligned with Q5V043_HALMA | Q5V043 from UniProtKB/TrEMBL Length:108 Alignment length:89 1 | 8 18 28 38 48 58 68 78 Q5V043_HALMA - --MRQSGSWMTIWDDRILEIIHEEGNGSPKELEDRDEIRISKSSVSRRLKKLADHDLLQPLANGVYVITEEGEAYLNGEYDAGKERYIN 87 SCOP domains ----------------------------------------------------------------------------------------- SCOP domains CATH domains 3b73B00 B:-1-87 'winged helix' repressor DNA binding domain CATH domains Pfam domains ----------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------- Transcript 3b73 B -1 NAmRQSGSWmTIWDDRILEIIHEEGNGSPKELEDRDEIRISKSSVSRRLKKLADHDLLQPLANGVYVITEEGEAYLNGEYDAGKERYIN 87 | 8 18 28 38 48 58 68 78 1-MSE 8-MSE
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3B73) |
CATH Domains (1, 2)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3B73) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3B73)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|