|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 3B4M) |
(no "Site" information available for 3B4M) |
(no "SS Bond" information available for 3B4M) |
(no "Cis Peptide Bond" information available for 3B4M) |
(no "SAP(SNP)/Variant" information available for 3B4M) |
Asymmetric Unit (1, 4)
|
Asymmetric Unit (4, 16)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:80 aligned with PABP2_HUMAN | Q86U42 from UniProtKB/Swiss-Prot Length:306 Alignment length:80 178 188 198 208 218 228 238 248 PABP2_HUMAN 169 ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKR 248 SCOP domains d3b4ma_ A: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---RRM PDB: A:172-248 UniProt: 172-249 PROSITE Transcript 1 (1) Exon 1.3 Exon 1.4 PDB: A:179-214 -----------------------------1.6a Transcript 1 (1) Transcript 1 (2) ---------------------------------------------Exon 1.5 PDB: A:214-243 ----- Transcript 1 (2) 3b4m A 169 ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKR 248 178 188 198 208 218 228 238 248 Chain B from PDB Type:PROTEIN Length:80 aligned with PABP2_HUMAN | Q86U42 from UniProtKB/Swiss-Prot Length:306 Alignment length:80 178 188 198 208 218 228 238 248 PABP2_HUMAN 169 ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKR 248 SCOP domains d3b4mb_ B: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---RRM PDB: B:172-248 UniProt: 172-249 PROSITE Transcript 1 (1) Exon 1.3 Exon 1.4 PDB: B:179-214 -----------------------------1.6a Transcript 1 (1) Transcript 1 (2) ---------------------------------------------Exon 1.5 PDB: B:214-243 ----- Transcript 1 (2) 3b4m B 169 ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKR 248 178 188 198 208 218 228 238 248 Chain C from PDB Type:PROTEIN Length:80 aligned with PABP2_HUMAN | Q86U42 from UniProtKB/Swiss-Prot Length:306 Alignment length:80 178 188 198 208 218 228 238 248 PABP2_HUMAN 169 ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKR 248 SCOP domains d3b4mc_ C: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---RRM PDB: C:172-248 UniProt: 172-249 PROSITE Transcript 1 (1) Exon 1.3 Exon 1.4 PDB: C:179-214 -----------------------------1.6a Transcript 1 (1) Transcript 1 (2) ---------------------------------------------Exon 1.5 PDB: C:214-243 ----- Transcript 1 (2) 3b4m C 169 ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKR 248 178 188 198 208 218 228 238 248 Chain D from PDB Type:PROTEIN Length:79 aligned with PABP2_HUMAN | Q86U42 from UniProtKB/Swiss-Prot Length:306 Alignment length:79 178 188 198 208 218 228 238 PABP2_HUMAN 169 ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPK 247 SCOP domains d3b4md_ D: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---RRM PDB: D:172-247 UniProt: 172-249 PROSITE Transcript 1 (1) Exon 1.3 Exon 1.4 PDB: D:179-214 -----------------------------1.6a Transcript 1 (1) Transcript 1 (2) ---------------------------------------------Exon 1.5 PDB: D:214-243 ---- Transcript 1 (2) 3b4m D 169 ADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPK 247 178 188 198 208 218 228 238
|
Asymmetric Unit
|
(no "CATH Domain" information available for 3B4M) |
(no "Pfam Domain" information available for 3B4M) |
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D (PABP2_HUMAN | Q86U42)
|
|
|
|
|
|
|