Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF RAT TOM20-ALDH PRESEQUENCE COMPLEX: A COMPLEX (FORM2) BETWEEN TOM20 AND A DISULFIDE-BRIDGED PRESEQUENCE PEPTIDE CONTAINING D-CYS AND L-CYS AT THE I AND I+3 POSITIONS.
 
Authors :  T. Saitoh, Y. Maita, D. Kohda
Date :  28 Mar 11  (Deposition) - 06 Jul 11  (Release) - 06 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,F  (1x)
Biol. Unit 4:  G,H  (1x)
Keywords :  Protein-Protein Complex, Membrane Protein-Transport Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. Saitoh, M. Igura, Y. Miyazaki, T. Ose, N. Maita, D. Kohda
Crystallographic Snapshots Of Tom20-Mitochondrial Presequence Interactions With Disulfide-Stabilized Peptides
Biochemistry V. 50 5487 2011
PubMed-ID: 21591667  |  Reference-DOI: 10.1021/BI200470X

(-) Compounds

Molecule 1 - MITOCHONDRIAL IMPORT RECEPTOR SUBUNIT TOM20 HOMOLOG
    Chains: A, C, E, G
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PGEX-6P-1
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: CYTOSOLIC DOMAIN, UNP RESIDUES 59-126
    Mutation: YES
    Organism Common: RAT
    Organism Scientific: RATTUS NORVEGICUS
    Organism Taxid: 10116
    Synonym: MITOCHONDRIAL 20 KDA OUTER MEMBRANE PROTEIN, OUTER MITOCHONDRIAL MEMBRANE RECEPTOR TOM20
 
Molecule 2 - ALDEHYDE DEHYDROGENASE, MITOCHONDRIAL
    Chains: B, D, F, H
    Engineered: YES
    Fragment: C-TERMINAL HALF, UNP RESIDUES 12-20
    Mutation: YES
    Organism Common: RAT
    Organism Scientific: RATTUS NORVEGICUS
    Organism Taxid: 10116
    Other Details: THE PEPTIDE WAS CHEMICALLY SYNTHESIZED.
    Synonym: ALDH CLASS 2, ALDH-E2, ALDH1
    Synthetic: YES

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit : ABCDEFGH
Biological Unit 1 (1x): AB      
Biological Unit 2 (1x):   CD    
Biological Unit 3 (1x):     EF  
Biological Unit 4 (1x):       GH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric Unit (2, 8)
No.NameCountTypeFull Name
1DCY4Mod. Amino AcidD-CYSTEINE
2NH24Mod. Amino AcidAMINO GROUP
Biological Unit 1 (2, 2)
No.NameCountTypeFull Name
1DCY1Mod. Amino AcidD-CYSTEINE
2NH21Mod. Amino AcidAMINO GROUP
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
1DCY1Mod. Amino AcidD-CYSTEINE
2NH21Mod. Amino AcidAMINO GROUP
Biological Unit 3 (2, 2)
No.NameCountTypeFull Name
1DCY1Mod. Amino AcidD-CYSTEINE
2NH21Mod. Amino AcidAMINO GROUP
Biological Unit 4 (2, 2)
No.NameCountTypeFull Name
1DCY1Mod. Amino AcidD-CYSTEINE
2NH21Mod. Amino AcidAMINO GROUP

(-) Sites  (0, 0)

(no "Site" information available for 3AX3)

(-) SS Bonds  (4, 4)

Asymmetric Unit
No.Residues
1B:13 -B:16
2D:13 -D:16
3F:13 -F:16
4H:13 -H:16

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 3AX3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3AX3)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3AX3)

(-) Exons   (2, 8)

Asymmetric Unit (2, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSRNOT000000270881ENSRNOE00000194302chr19:56863167-56862937231TOM20_RAT1-41410--
1.2ENSRNOT000000270882ENSRNOE00000194357chr19:56859134-5685908847TOM20_RAT41-56160--
1.3ENSRNOT000000270883ENSRNOE00000194378chr19:56857774-5685769382TOM20_RAT57-84284A:61-84
C:61-84
E:59-84
G:59-84		24
24
26
26
1.4ENSRNOT000000270884ENSRNOE00000344303chr19:56852725-56852583143TOM20_RAT84-131484A:84-126
C:84-126
E:84-126
G:84-126		43
43
43
43
1.5ENSRNOT000000270885ENSRNOE00000194431chr19:56851327-56850851477TOM20_RAT132-145140--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:66
 aligned with TOM20_RAT | Q62760 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:66
                                    70        80        90       100       110       120      
            TOM20_RAT    61 KDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL 126
               SCOP domains ------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.3  PDB: A:61-84  ------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.4  PDB: A:84-126 UniProt: 84-131     Transcript 1 (2)
                 3ax3 A  61 KDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVSGQPQQLLQVLQQTLPPPVFQMLLTKL 126
                                    70        80        90       100       110       120      


Chain B from PDB  Type:PROTEIN  Length:12
 aligned with ALDH2_RAT | P11884 from UniProtKB/Swiss-Prot  Length:519

    Alignment length:12
                                    21  
            ALDH2_RAT    12 GPRLSRLLSAAA  23
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
               Pfam domains ------------ Pfam domains
         Sec.struct. author .hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------ SAPs(SNPs)
                    PROSITE ------------ PROSITE
                 Transcript ------------ Transcript
                 3ax3 B  12 GxRLCRLLSYAx  23
                             |      21 |
                             |        23-NH2
                            13-DCY      


Chain C from PDB  Type:PROTEIN  Length:66
 aligned with TOM20_RAT | Q62760 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:66
                                    70        80        90       100       110       120      
            TOM20_RAT    61 KDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL 126
               SCOP domains ------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.3  PDB: C:61-84  ------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.4  PDB: C:84-126 UniProt: 84-131     Transcript 1 (2)
                 3ax3 C  61 KDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVSGQPQQLLQVLQQTLPPPVFQMLLTKL 126
                                    70        80        90       100       110       120      


Chain D from PDB  Type:PROTEIN  Length:12
 aligned with ALDH2_RAT | P11884 from UniProtKB/Swiss-Prot  Length:519

    Alignment length:12
                                    21  
            ALDH2_RAT    12 GPRLSRLLSAAA  23
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
               Pfam domains ------------ Pfam domains
         Sec.struct. author .hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------ SAPs(SNPs)
                    PROSITE ------------ PROSITE
                 Transcript ------------ Transcript
                 3ax3 D  12 GxRLCRLLSYAx  23
                             |      21 |
                             |        23-NH2
                            13-DCY      


Chain E from PDB  Type:PROTEIN  Length:68
 aligned with TOM20_RAT | Q62760 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:68
                                    68        78        88        98       108       118        
            TOM20_RAT    59 DLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL 126
               SCOP domains -------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: E:59-84    ------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -------------------------Exon 1.4  PDB: E:84-126 UniProt: 84-131     Transcript 1 (2)
                 3ax3 E  59 DLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVSGQPQQLLQVLQQTLPPPVFQMLLTKL 126
                                    68        78        88        98       108       118        


Chain F from PDB  Type:PROTEIN  Length:12
 aligned with ALDH2_RAT | P11884 from UniProtKB/Swiss-Prot  Length:519

    Alignment length:12
                                    21  
            ALDH2_RAT    12 GPRLSRLLSAAA  23
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
               Pfam domains ------------ Pfam domains
         Sec.struct. author .hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------ SAPs(SNPs)
                    PROSITE ------------ PROSITE
                 Transcript ------------ Transcript
                 3ax3 F  12 GxRLCRLLSYAx  23
                             |      21 |
                             |        23-NH2
                            13-DCY      


Chain G from PDB  Type:PROTEIN  Length:68
 aligned with TOM20_RAT | Q62760 from UniProtKB/Swiss-Prot  Length:145

    Alignment length:68
                                    68        78        88        98       108       118        
            TOM20_RAT    59 DLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL 126
               SCOP domains -------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh..hhhhhhhhhh...hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: G:59-84    ------------------------------------------ Transcript 1 (1)
           Transcript 1 (2) -------------------------Exon 1.4  PDB: G:84-126 UniProt: 84-131     Transcript 1 (2)
                 3ax3 G  59 DLKDAEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVSGQPQQLLQVLQQTLPPPVFQMLLTKL 126
                                    68        78        88        98       108       118        


Chain H from PDB  Type:PROTEIN  Length:12
 aligned with ALDH2_RAT | P11884 from UniProtKB/Swiss-Prot  Length:519

    Alignment length:12
                                    21  
            ALDH2_RAT    12 GPRLSRLLSAAA  23
               SCOP domains ------------ SCOP domains
               CATH domains ------------ CATH domains
               Pfam domains ------------ Pfam domains
         Sec.struct. author .hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------ SAPs(SNPs)
                    PROSITE ------------ PROSITE
                 Transcript ------------ Transcript
                 3ax3 H  12 GxRLCRLLSYAx  23
                             |      21 |
                             |        23-NH2
                            13-DCY
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3AX3)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3AX3)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3AX3)

(-) Gene Ontology  (40, 41)

Asymmetric Unit(hide GO term definitions)
Chain A,C,E,G   (TOM20_RAT | Q62760)
molecular function
    GO:0015450    P-P-bond-hydrolysis-driven protein transmembrane transporter activity    Primary active carrier-mediated transport of a protein across a membrane, driven by the hydrolysis of the diphosphate bond of inorganic pyrophosphate, ATP, or another nucleoside triphosphate. The transport protein may or may not be transiently phosphorylated, but the substrate is not phosphorylated.
    GO:0030943    mitochondrion targeting sequence binding    Interacting selectively and non-covalently with a mitochondrion targeting sequence, a specific peptide sequence that acts as a signal to localize the protein within the mitochondrion.
    GO:0015266    protein channel activity    Enables the energy-independent facilitated diffusion, mediated by passage of proteins through a transmembrane aqueous pore or channel.
    GO:0051082    unfolded protein binding    Interacting selectively and non-covalently with an unfolded protein.
biological process
    GO:0006886    intracellular protein transport    The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
    GO:0070096    mitochondrial outer membrane translocase complex assembly    The aggregation, arrangement and bonding together of a set of components to form a mitochondrial outer membrane translocase complex.
    GO:0030150    protein import into mitochondrial matrix    The import of proteins across the outer and inner mitochondrial membranes into the matrix. Unfolded proteins enter the mitochondrial matrix with a chaperone protein; the information required to target the precursor protein from the cytosol to the mitochondrial matrix is contained within its N-terminal matrix-targeting sequence. Translocation of precursors to the matrix occurs at the rare sites where the outer and inner membranes are close together.
    GO:0006605    protein targeting    The process of targeting specific proteins to particular regions of the cell, typically membrane-bounded subcellular organelles. Usually requires an organelle specific protein sequence motif.
    GO:0006626    protein targeting to mitochondrion    The process of directing proteins towards and into the mitochondrion, usually mediated by mitochondrial proteins that recognize signals contained within the imported protein.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0016031    tRNA import into mitochondrion    The directed movement of tRNA, transfer ribonucleic acid, from the cytoplasm into a mitochondrion.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0044233    ER-mitochondrion membrane contact site    A zone of apposition between endoplasmic-reticulum and mitochondrial membranes, structured by bridging complexes. These contact sites are thought to facilitate inter-organelle calcium and phospholipid exchange.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0031307    integral component of mitochondrial outer membrane    The component of the mitochondrial outer membrane consisting of the gene products having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005740    mitochondrial envelope    The double lipid bilayer enclosing the mitochondrion and separating its contents from the cell cytoplasm; includes the intermembrane space.
    GO:0005741    mitochondrial outer membrane    The outer, i.e. cytoplasm-facing, lipid bilayer of the mitochondrial envelope.
    GO:0005742    mitochondrial outer membrane translocase complex    A large complex of the mitochondrial outer membrane that mediates transport of proteins into all mitochondrial compartments.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Chain B,D,F,H   (ALDH2_RAT | P11884)
molecular function
    GO:0070404    NADH binding    Interacting selectively and non-covalently with the reduced form, NADH, of nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions.
    GO:0004029    aldehyde dehydrogenase (NAD) activity    Catalysis of the reaction: an aldehyde + NAD+ + H2O = an acid + NADH + H+.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016620    oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor    Catalysis of an oxidation-reduction (redox) reaction in which an aldehyde or ketone (oxo) group acts as a hydrogen or electron donor and reduces NAD or NADP.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0071398    cellular response to fatty acid    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a fatty acid stimulus.
    GO:0032870    cellular response to hormone stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hormone stimulus.
    GO:0006068    ethanol catabolic process    The chemical reactions and pathways resulting in the breakdown of ethanol, CH3-CH2-OH, a colorless, water-miscible, flammable liquid produced by alcoholic fermentation.
    GO:0001889    liver development    The process whose specific outcome is the progression of the liver over time, from its formation to the mature structure. The liver is an exocrine gland which secretes bile and functions in metabolism of protein and carbohydrate and fat, synthesizes substances involved in the clotting of the blood, synthesizes vitamin A, detoxifies poisonous substances, stores glycogen, and breaks down worn-out erythrocytes.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0032355    response to estradiol    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of stimulus by estradiol, a C18 steroid hormone hydroxylated at C3 and C17 that acts as a potent estrogen.
    GO:0055093    response to hyperoxia    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating increased oxygen tension.
    GO:0032496    response to lipopolysaccharide    Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
    GO:0035094    response to nicotine    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nicotine stimulus.
    GO:0032570    response to progesterone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a progesterone stimulus.
    GO:0033574    response to testosterone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a testosterone stimulus.
cellular component
    GO:0005759    mitochondrial matrix    The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DCY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NH2  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 3ax3)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3ax3)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3ax3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ALDH2_RAT | P11884
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  TOM20_RAT | Q62760
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ALDH2_RAT | P11884
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TOM20_RAT | Q62760
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ALDH2_RAT | P11884: 1om2 2v1s 2v1t 3awr 3ax2 3ax5 5az8
        TOM20_RAT | Q62760: 1om2 2v1s 2v1t 3awr 3ax2 3ax5 5az6 5az7 5az8 5az9

(-) Related Entries Specified in the PDB File

3awr 3ax2 3ax5