Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF STREPTOMYCES TYROSINASE IN A COMPLEX WITH CADDIE SOAKED IN A CU(II)-CONTAINING SOLUTION FOR 40 H
 
Authors :  Y. Matoba, M. Sugiyama
Date :  26 Mar 11  (Deposition) - 29 Jun 11  (Release) - 31 Aug 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.16
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Tyrosinase, Binary Complex, Type-3 Copper, Copper Transfer, Oxidoreductase-Metal Transport Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Matoba, N. Bando, K. Oda, M. Noda, F. Higashikawa, T. Kumagai, M. Sugiyama
A Molecular Mechanism For Copper Transportation To Tyrosinase That Is Assisted By A Metallochaperone, Caddie Protein
J. Biol. Chem. V. 286 30219 2011
PubMed-ID: 21730070  |  Reference-DOI: 10.1074/JBC.M111.256818
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TYROSINASE
    Chains: A
    EC Number: 1.14.18.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-MEL2
    Expression System Strain: BL21(DE3)PLYSS
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: TYRC
    Organism Scientific: STREPTOMYCES CASTANEOGLOBISPORUS
    Organism Taxid: 79261
    Strain: HUT 6202
 
Molecule 2 - MELC
    Chains: B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-MEL2
    Expression System Strain: BL21(DE3)PLYSS
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: ORF378
    Organism Scientific: STREPTOMYCES CASTANEOGLOBISPORUS
    Organism Taxid: 79261
    Strain: HUT 6202
    Synonym: CADDIE PROTEIN ORF378

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 10)

Asymmetric/Biological Unit (2, 10)
No.NameCountTypeFull Name
1CU4Ligand/IonCOPPER (II) ION
2NO36Ligand/IonNITRATE ION

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:38 , HIS A:54 , HIS A:63 , CU A:501 , HOH A:510 , TYR B:98 , HOH B:580BINDING SITE FOR RESIDUE CU A 500
02AC2SOFTWAREHIS A:190 , HIS A:194 , HIS A:216 , CU A:500 , HOH A:510 , HOH B:580BINDING SITE FOR RESIDUE CU A 501
03AC3SOFTWAREHIS A:277 , HIS A:279 , HOH A:675BINDING SITE FOR RESIDUE CU A 503
04AC4SOFTWAREARG A:132 , VAL A:133 , ASP A:134 , ARG A:140 , GLN A:200 , THR A:203 , VAL A:205 , HOH A:644 , HOH A:666BINDING SITE FOR RESIDUE NO3 A 505
05AC5SOFTWARETYR A:165 , TRP A:223 , TRP A:226 , GLN A:227 , ALA A:234 , TYR A:235 , LEU A:263 , HOH A:734BINDING SITE FOR RESIDUE NO3 A 506
06AC6SOFTWARETHR A:238 , GLY A:239 , ASP A:246 , LEU A:247 , ASN A:248 , HOH A:761 , LYS B:50 , HOH B:631 , HOH B:716BINDING SITE FOR RESIDUE NO3 A 508
07AC7SOFTWAREARG A:228 , HIS A:265 , THR A:266 , THR A:270 , PHE A:271 , LEU A:274 , HOH A:782 , HOH A:906BINDING SITE FOR RESIDUE NO3 A 509
08AC8SOFTWAREILE A:42 , MET A:43 , GLU B:67 , HIS B:68 , HIS B:82 , MET B:84 , HIS B:97 , NO3 B:504BINDING SITE FOR RESIDUE CU B 502
09AC9SOFTWAREHIS B:82 , VAL B:83 , MET B:84 , ILE B:92 , SER B:93 , VAL B:94 , HIS B:97 , CU B:502BINDING SITE FOR RESIDUE NO3 B 504
10BC1SOFTWAREGLY A:125 , PRO A:128 , HOH A:687 , THR B:103 , ARG B:105 , ALA B:106 , ARG B:109 , HOH B:646BINDING SITE FOR RESIDUE NO3 B 507

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3AWU)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Pro A:168 -Pro A:169
2Val A:236 -Pro A:237
3Lys A:252 -Pro A:253

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3AWU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3AWU)

(-) Exons   (0, 0)

(no "Exon" information available for 3AWU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:278
 aligned with Q83WS2_9ACTN | Q83WS2 from UniProtKB/TrEMBL  Length:273

    Alignment length:278
                                                                                                                                                                                                                                                                                                         273      
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271 |      
         Q83WS2_9ACTN     2 TVRKNQATLTADEKRRFVAAVLELKRSGRYDEFVRTHNEFIMSDTDSGERTGHRSPSFLPWHRRFLLDFEQALQSVDSSVTLPYWDWSADRTVRASLWAPDFLGGTGRSTDGRVMDGPFAAFTGNWPINVRVDSRTYLRRSLGGSVAELPTRAEVESVLAISAYDLPPYNSASEGFRNHLEGWRGVNLHNRVHVWVGGQMATGVSPNDPVFWLHHAYVDKLWAEWQRRHPDSAYVPTGGTPDVVDLNETMKPWNTVRPADLLDHTAYYTFDA------   -
               SCOP domains d3awua_ A: Tyrosinase                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhh.................hhhhh....................hhhhh..........................hhhhhhhhhh..............hhhhhhhh.....hhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh...........................hhhhhhhhhhh.ee........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3awu A   2 TVRKNQATLTADEKRRFVAAVLELKRSGRYDEFVRTHNEFIMSDTDSGERTGHRSPSFLPWHRRFLLDFEQALQSVDSSVTLPYWDWSADRTVRASLWAPDFLGGTGRSTDGRVMDGPFAASTGNWPINVRVDSRTYLRRSLGGSVAELPTRAEVESVLAISAYDLPPYNSASEGFRNHLEGWRGVNLHNRVHVWVGGQMATGVSPNDPVFWLHHAYVDKLWAEWQRRHPDSAYVPTGGTPDVVDLNETMKPWNTVRPADLLDHTAYYTFDALEHHHH 279
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271        


Chain B from PDB  Type:PROTEIN  Length:78
 aligned with Q83WS1_9ACTN | Q83WS1 from UniProtKB/TrEMBL  Length:126

    Alignment length:84
                                    49        59        69        79        89        99       109       119    
         Q83WS1_9ACTN    40 AAPESFDEVYKGRRIQGRPAGGGAHHHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLPF 123
               SCOP domains d3awub_ B: Tyrosinas      e cofactor MelC1                                           SCOP domains
               CATH domains ------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeeee..eeeeeee.------......eeeee..eee.eee.....eee..eeeeee.hhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------ Transcript
                 3awu B  40 AAPESFDEVYKGRRIQGRPA------HEHGGGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLPF 123
                                    49        59      | 69        79        89        99       109       119    
                                              59     66
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3AWU)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3AWU)

(-) Gene Ontology  (6, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q83WS2_9ACTN | Q83WS2)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain B   (Q83WS1_9ACTN | Q83WS1)
molecular function
    GO:0005507    copper ion binding    Interacting selectively and non-covalently with copper (Cu) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0042438    melanin biosynthetic process    The chemical reactions and pathways resulting in the formation of melanins, pigments largely of animal origin. High molecular weight polymers of indole quinone, they are irregular polymeric structures and are divided into three groups: allomelanins in the plant kingdom and eumelanins and phaeomelanins in the animal kingdom.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NO3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Lys A:252 - Pro A:253   [ RasMol ]  
    Pro A:168 - Pro A:169   [ RasMol ]  
    Val A:236 - Pro A:237   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3awu
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q83WS1_9ACTN | Q83WS1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q83WS2_9ACTN | Q83WS2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.14.18.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q83WS1_9ACTN | Q83WS1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q83WS2_9ACTN | Q83WS2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q83WS1_9ACTN | Q83WS1: 1wx2 1wx4 1wx5 1wxc 2ahk 2ahl 2zmx 2zmy 2zmz 2zwd 2zwe 2zwf 2zwg 3aws 3awt 3awv 3aww 3awx 3awy 3awz 3ax0
        Q83WS2_9ACTN | Q83WS2: 1wx2 1wx4 1wx5 1wxc 2ahk 2ahl 2zmx 2zmy 2zmz 2zwd 2zwe 2zwf 2zwg 3aws 3awt 3awv 3aww 3awx 3awy 3awz 3ax0

(-) Related Entries Specified in the PDB File

3aws 3awt 3awv 3aww 3awx 3awy 3awz 3ax0