Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  C-TERMINAL DOMAIN OF KIPI FROM BACILLUS SUBTILIS
 
Authors :  D. B. Langley, D. A. Jacques
Date :  24 Jun 08  (Deposition) - 20 Jan 09  (Release) - 20 Jan 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.01
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Kipi, Histidine Kinase Inhibitor, Atp-Binding, Nucleotide- Binding, Protein Kinase Inhibitor, Sporulation, Transferase Inhibitor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. A. Jacques, D. B. Langley, C. M. Jeffries, K. A. Cunningham, W. F. Burkholder, J. M. Guss, J. Trewhella
Histidine Kinase Regulation By A Cyclophilin-Like Inhibitor
J. Mol. Biol. V. 384 422 2008
PubMed-ID: 18823995  |  Reference-DOI: 10.1016/J.JMB.2008.09.017
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - KINASE A INHIBITOR
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET (NOVAGEN)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: C-TERMINAL DOMAIN, UNP RESIDUES 100-240
    Gene: KIPI
    Organism Scientific: BACILLUS SUBTILIS
    Organism Taxid: 1423
    Strain: 168
    Synonym: SPORULATION INHIBITOR KIPI

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2ZP2)

(-) Sites  (0, 0)

(no "Site" information available for 2ZP2)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2ZP2)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Pro A:202 -Leu A:203

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2ZP2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2ZP2)

(-) Exons   (0, 0)

(no "Exon" information available for 2ZP2)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:121
 aligned with KIPI_BACSU | P60495 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:132
                                   109       119       129       139       149       159       169       179       189       199       209       219       229  
           KIPI_BACSU   100 RIVEIPVCYGGEFGPDLEEVAKINQLSPEEVIDIHTNGEYVVYMLGFAPGFPFLGGMSKRIAAPRKSSPRPSIPAGSVGIAGLQTGVYPISTPGGWQLIGKTPLALFRPQENPPTLLRAGDIVKFVRISEKD 231
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2zp2A00 A:100-231 Cyclophilin                                                                                                        CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeeeee......hhhhhhhhh..hhhhhhhhhh...eeee...--....eee..hhhhh..............eeeee..eeee.........eeeee....---------.......eeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2zp2 A 100 RIVEIPVCYGGEFGPDLEEVAKINQLSPEEVIDIHTNGEYVVYMLG--PGFPFLGGMSKRIAAPRKSSPRPSIPAGSVGIAGLQTGVYPISTPGGWQLIGKTPLA---------TLLRAGDIVKFVRISEKD 231
                                   109       119       129       139     | 149       159       169       179       189       199    |    -    |  219       229  
                                                                       145  |                                                     204       214                 
                                                                          148                                                                                   


Chain B from PDB  Type:PROTEIN  Length:123
 aligned with KIPI_BACSU | P60495 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:132
                                   109       119       129       139       149       159       169       179       189       199       209       219       229  
           KIPI_BACSU   100 RIVEIPVCYGGEFGPDLEEVAKINQLSPEEVIDIHTNGEYVVYMLGFAPGFPFLGGMSKRIAAPRKSSPRPSIPAGSVGIAGLQTGVYPISTPGGWQLIGKTPLALFRPQENPPTLLRAGDIVKFVRISEKD 231
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2zp2B00 B:100-231 Cyclophilin                                                                                                        CATH domains
           Pfam domains (1) AHS1-2zp2B01 B:100-216                                                                                               --------------- Pfam domains (1)
           Pfam domains (2) AHS1-2zp2B02 B:100-216                                                                                               --------------- Pfam domains (2)
         Sec.struct. author .eee...........hhhhhhhhh..hhhhhhhhhhh..eeee.........eee..............eeee...eeeee..eeee....eee..eeeee......---------.....eee........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2zp2 B 100 RIVEIPVCYGGEFGPDLEEVAKINQLSPEEVIDIHTNGEYVVYMLGFAPGFPFLGGMSKRIAAPRKSSPRPSIPAGSVGIAGLQTGVYPISTPGGWQLIGKTPLALF---------LRAGDIVKFVRISEKD 231
                                   109       119       129       139       149       159       169       179       189       199      |  -      |219       229  
                                                                                                                                    206       216
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2ZP2)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: Cyclophil-like (65)
(-)
Family: AHS1 (7)
(-)
Bacillus subtilis (2)
1aAHS1-2zp2B01B:100-216
1bAHS1-2zp2B02B:100-216

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (KIPI_BACSU | P60495)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0004860    protein kinase inhibitor activity    Stops, prevents or reduces the activity of a protein kinase, an enzyme which phosphorylates a protein.
biological process
    GO:0006469    negative regulation of protein kinase activity    Any process that stops, prevents, or reduces the frequency, rate or extent of protein kinase activity.
    GO:0030435    sporulation resulting in formation of a cellular spore    The process in which a relatively unspecialized cell acquires the specialized features of a cellular spore, a cell form that can be used for dissemination, for survival of adverse conditions because of its heat and dessication resistance, and/or for reproduction.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2zp2)
 
  Sites
(no "Sites" information available for 2zp2)
 
  Cis Peptide Bonds
    Pro A:202 - Leu A:203   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2zp2
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KIPI_BACSU | P60495
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  KIPI_BACSU | P60495
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KIPI_BACSU | P60495: 2kwa

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2ZP2)