Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE KIF1A MOTOR DOMAIN DURING MG RELEASE: MG-RELEASING TRANSITION-1
 
Authors :  R. Nitta, Y. Okada, N. Hirokawa
Date :  08 Jan 08  (Deposition) - 23 Sep 08  (Release) - 05 Jan 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.20
Chains :  Asym./Biol. Unit :  A
Keywords :  Kinesin, Alpha And Beta Protein, Enzyme, Atpase, P-Loop, Motor Protein, Atp-Binding, Coiled Coil, Microtubule, Nucleotide-Binding, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Nitta, Y. Okada, N. Hirokawa
Structural Model For Strain-Dependent Microtubule Activation Of Mg-Adp Release From Kinesin.
Nat. Struct. Mol. Biol. V. 15 1067 2008
PubMed-ID: 18806800  |  Reference-DOI: 10.1038/NSMB.1487
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - KINESIN-LIKE PROTEIN KIF1A, KINESIN HEAVY CHAIN ISOFORM 5C
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET21B
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentKIF1A (RESIDUES 1-355), KIF5C (RESIDUES 329-334)
    Organism CommonMOUSE
    Organism ScientificMUS MUSCULUS
    Organism Taxid10090
    Other DetailsFUSION PROTEIN COMPRISES RESIDUES 1-355 OF KINESIN-LIKE PROTEIN KIF1A, AND RESIDUES 329-334 OF KINESIN HEAVY CHAIN ISOFORM 5C, AND C-TERMINAL TAIL WITH SEQUENCE HHHHH
    SynonymAXONAL TRANSPORTER OF SYNAPTIC VESI CLES, KINESIN HEAVY CHAIN NEURON-SPECIFIC 2

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
1ADP1Ligand/IonADENOSINE-5'-DIPHOSPHATE
2MG1Ligand/IonMAGNESIUM ION

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:11 , ARG A:13 , PRO A:14 , SER A:58 , ASP A:64 , ILE A:65 , TYR A:67 , GLN A:98 , THR A:99 , GLY A:100 , ALA A:101 , GLY A:102 , LYS A:103 , SER A:104 , TYR A:105 , LYS A:110BINDING SITE FOR RESIDUE ADP A2000

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2ZFJ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2ZFJ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2ZFJ)

(-) PROSITE Motifs  (2, 3)

Asymmetric/Biological Unit (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1KINESIN_MOTOR_2PS50067 Kinesin motor domain profile.KIF1A_MOUSE5-354  1A:5-352
KIF5C_MOUSE8-327  1A:5-352
2KINESIN_MOTOR_1PS00411 Kinesin motor domain signature.KIF5C_MOUSE226-237  1A:243-253
KIF1A_MOUSE242-253  1A:242-253

(-) Exons   (0, 0)

(no "Exon" information available for 2ZFJ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:309
 aligned with KIF1A_MOUSE | P33173 from UniProtKB/Swiss-Prot  Length:1695

    Alignment length:348
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344        
          KIF1A_MOUSE     5 SVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAK 352
               SCOP domains d2zfja1 A:5-352 Kinesin                                                                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains 2zfjA00 A:5-352 Kinesin                                                                                                                                                                                                                                                                                                                                      CATH domains
               Pfam domains ------Kinesin-2zfjA01 A:11-352                                                                                                                                                                                                                                                                                                                               Pfam domains
         Sec.struct. author ...eeeee...hhhhhhh.....eee....eee..........ee....eeee...........hhhhhhhhhhhhhhhhhhhh..eeeeee.....hhhhhhh........hhhhhhhhhhhhhhhh.....eeeeeeeeeeeee..eee.......--...eeee...eeee.....eee.hhhhhhhhhhhhhh..--------......eeeeeeeeeeeee......eeeeeeeeeeee.....------------hhhhhhhhhhhhhhhhhhhhh-----------------.....hhhhhhhhhhhh....eeeeeee..hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) KINESIN_MOTOR_2  PDB: A:5-352 UniProt: 5-354                                                                                                                                                                                                                                                                                                                 PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KINESIN_MOTO--------------------------------------------------------------------------------------------------- PROSITE (3)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2zfj A   5 SVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKN--NLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPR--------ETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSE------------KEGANINKSLTTLGKVISALA-----------------IPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAK 352
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       | -|      174       184       194        |-       214       224       234       244        |-         - |     274       284 |       -       304       314       324       334       344        
                                                                                                                                                                                       162  |                                   203      212                                      253          266                 286               304                                                
                                                                                                                                                                                          165                                                                                                                                                                                           

Chain A from PDB  Type:PROTEIN  Length:309
 aligned with KIF5C_MOUSE | P28738 from UniProtKB/Swiss-Prot  Length:956

    Alignment length:337
                                                                                                                                                            123                                                                                                                                                                                                              
                                                                 46     47                         74       75                                            122 |                                                                                                   225  226                                                                                                   
                                    17        27        37        |-     |  51        61        71  |      - |      83        93       103       113        |-|      132       142       152       162       172       182       192       202       212       222  |    228       238       248       258       268       278       288       298       308       318       
          KIF5C_MOUSE     8 SIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKP------YVFDRVLPPNTTQEQVYNACAKQIVKDV--------LEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYS-MDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLS----GKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAK 325
               SCOP domains d2zfja1 A:5-352 Kinesin                                                                                                                                                                                                                                                                                                                           SCOP domains
               CATH domains 2zfjA00 A:5-352 Kinesin                                                                                                                                                                                                                                                                                                                           CATH domains
               Pfam domains ------Kinesin-2zfjA01 A:11-352                                                                                                                                                                                                                                                                                                                    Pfam domains
         Sec.struct. author ...eeeee...hhhhhhh.....eee....eee..........ee....eeee...........hhhhhhhhhhhhhhhhhhhh..eeeeee.....hhhhhhh.......-.hhhhhhhhhhhhhhhh.....eeeeeeeeeeeee..eee.......-...eeee...eeee.....eee.hhhhhhhhhhhhhh..--------......eeeeeeeeeeeee......eeeeeeeeeeee.....------------hhhhhhhhhhhhhhhhhhhhh------.....hhhhhhhhhhhh....eeeeeee..hhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) KINESIN_MOTOR_2  PDB: A:5-352 UniProt: 8-327                                                                                                                                                                                                                                                                                                      PROSITE (2)
                PROSITE (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KINESIN_MOTO---------------------------------------------------------------------------------------- PROSITE (3)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2zfj A   5 SVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQ-QGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKN-NLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPR--------ETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSE------------KEGANINKSLTTLGKVISALA------IPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAK 352
                                    14        24        34        44        54        64        74        84        94       104       114| |    123       133       143       153        |-|      174       184       194        |-       214       224       234       244        |-         - |     274       284 |     305       315       325       335       345       
                                                                                                                                        115 |                                           162 |                                   203      212                                      253          266                 286    304                                                
                                                                                                                                          116                                             165                                                                                                                                                                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit

(-) Gene Ontology  (21, 32)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (KIF5C_MOUSE | P28738)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0008574    ATP-dependent microtubule motor activity, plus-end-directed    Catalysis of movement along a microtubule toward the plus end, coupled to the hydrolysis of ATP.
    GO:0034190    apolipoprotein receptor binding    Interacting selectively and non-covalently with an apolipoprotein receptor.
    GO:0008017    microtubule binding    Interacting selectively and non-covalently with microtubules, filaments composed of tubulin monomers.
    GO:0003777    microtubule motor activity    Catalysis of movement along a microtubule, coupled to the hydrolysis of a nucleoside triphosphate (usually ATP).
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0030705    cytoskeleton-dependent intracellular transport    The directed movement of substances along cytoskeletal fibers such as microfilaments or microtubules within a cell.
    GO:0051028    mRNA transport    The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0007018    microtubule-based movement    A microtubule-based process that results in the movement of organelles, other microtubules, or other cellular components. Examples include motor-driven movement along microtubules and movement driven by polymerization or depolymerization of microtubules.
    GO:0008045    motor neuron axon guidance    The process in which the migration of an axon growth cone of a motor neuron is directed to a specific target site in response to a combination of attractive and repulsive cues.
    GO:0008104    protein localization    Any process in which a protein is transported to, or maintained in, a specific location.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0035253    ciliary rootlet    A cytoskeleton-like structure, originating from the basal body at the proximal end of a cilium, and extending proximally toward the cell nucleus. Rootlets are typically 80-100 nm in diameter and contain cross striae distributed at regular intervals of approximately 55-70 nm.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005871    kinesin complex    Any complex that includes a dimer of molecules from the kinesin superfamily, a group of related proteins that contain an extended region of predicted alpha-helical coiled coil in the main chain that likely produces dimerization. The native complexes of several kinesin family members have also been shown to contain additional peptides, often designated light chains as all of the noncatalytic subunits that are currently known are smaller than the chain that contains the motor unit. Kinesin complexes generally possess a force-generating enzymatic activity, or motor, which converts the free energy of the gamma phosphate bond of ATP into mechanical work.
    GO:0005874    microtubule    Any of the long, generally straight, hollow tubes of internal diameter 12-15 nm and external diameter 24 nm found in a wide variety of eukaryotic cells; each consists (usually) of 13 protofilaments of polymeric tubulin, staggered in such a manner that the tubulin monomers are arranged in a helical pattern on the microtubular surface, and with the alpha/beta axes of the tubulin subunits parallel to the long axis of the tubule; exist in equilibrium with pool of tubulin monomers and can be rapidly assembled or disassembled in response to physiological stimuli; concerned with force generation, e.g. in the spindle.
    GO:0043005    neuron projection    A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.

Chain A   (KIF1A_MOUSE | P33173)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016887    ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
    GO:0008017    microtubule binding    Interacting selectively and non-covalently with microtubules, filaments composed of tubulin monomers.
    GO:0003777    microtubule motor activity    Catalysis of movement along a microtubule, coupled to the hydrolysis of a nucleoside triphosphate (usually ATP).
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0030705    cytoskeleton-dependent intracellular transport    The directed movement of substances along cytoskeletal fibers such as microfilaments or microtubules within a cell.
    GO:0007018    microtubule-based movement    A microtubule-based process that results in the movement of organelles, other microtubules, or other cellular components. Examples include motor-driven movement along microtubules and movement driven by polymerization or depolymerization of microtubules.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005871    kinesin complex    Any complex that includes a dimer of molecules from the kinesin superfamily, a group of related proteins that contain an extended region of predicted alpha-helical coiled coil in the main chain that likely produces dimerization. The native complexes of several kinesin family members have also been shown to contain additional peptides, often designated light chains as all of the noncatalytic subunits that are currently known are smaller than the chain that contains the motor unit. Kinesin complexes generally possess a force-generating enzymatic activity, or motor, which converts the free energy of the gamma phosphate bond of ATP into mechanical work.
    GO:0005874    microtubule    Any of the long, generally straight, hollow tubes of internal diameter 12-15 nm and external diameter 24 nm found in a wide variety of eukaryotic cells; each consists (usually) of 13 protofilaments of polymeric tubulin, staggered in such a manner that the tubulin monomers are arranged in a helical pattern on the microtubular surface, and with the alpha/beta axes of the tubulin subunits parallel to the long axis of the tubule; exist in equilibrium with pool of tubulin monomers and can be rapidly assembled or disassembled in response to physiological stimuli; concerned with force generation, e.g. in the spindle.
    GO:0043005    neuron projection    A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
    GO:0043025    neuronal cell body    The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ADP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2zfj)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2zfj
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KIF1A_MOUSE | P33173
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  KIF5C_MOUSE | P28738
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KIF1A_MOUSE | P33173
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  KIF5C_MOUSE | P28738
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KIF1A_MOUSE | P331731i5s 1i6i 1ia0 1vfv 1vfw 1vfx 1vfz 2hxf 2hxh 2zfi 2zfk 2zfl 2zfm
        KIF5C_MOUSE | P287381vfv 1vfw 1vfx 1vfz 2zfi 2zfk 2zfl 2zfm 3j6h 3wrd 3x2t

(-) Related Entries Specified in the PDB File

1i5s 1i6i 1vfv 1vfw 1vfx 1vfz 2zfi 2zfk 2zfl 2zfm