Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PHOSPHATE PREPLASMIC BINDING PROTEIN PSTS FROM YERSINIA PESTIS
 
Authors :  M. Tanabe, B. Byrne, K. A. Brown, O. Mirza, T. Bertland
Date :  17 May 07  (Deposition) - 30 Oct 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,X
Biol. Unit 1:  X  (1x)
Biol. Unit 2:  A  (1x)
Keywords :  Abc Transporter, Phosphate Periplasmic Binding Receptor, Transport Protein, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Tanabe, O. Mirza, T. Bertrand, H. S. Atkins, R. W. Titball, S. Iwata, K. A. Brown, B. Byrne
Structures Of Oppa And Psts From Yersinia Pestis Indicate Variability Of Interactions With Transmembrane Domains.
Acta Crystallogr. , Sect. D V. 63 1185 2007
PubMed-ID: 18007034  |  Reference-DOI: 10.1107/S0907444907048299

(-) Compounds

Molecule 1 - PERIPLASMIC PHOSPHATE-BINDING PROTEIN
    Chains: X, A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET24A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: RESIDUES 1-321
    Organism Scientific: YERSINIA PESTIS
    Organism Taxid: 214092
    Strain: CO92
    Synonym: PUTATIVE PHOSPHATE-BINDING PERIPLASMIC PROTEIN

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AX
Biological Unit 1 (1x):  X
Biological Unit 2 (1x): A 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1PO42Ligand/IonPHOSPHATE ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1PO41Ligand/IonPHOSPHATE ION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1PO41Ligand/IonPHOSPHATE ION

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA X:9 , THR X:10 , PHE X:11 , GLY X:37 , SER X:38 , ASP X:56 , ARG X:135 , SER X:139 , GLY X:140 , THR X:141BINDING SITE FOR RESIDUE PO4 X 2322
2AC2SOFTWAREALA A:9 , THR A:10 , PHE A:11 , GLY A:37 , SER A:38 , ASP A:56 , ARG A:135 , SER A:139 , GLY A:140 , THR A:141BINDING SITE FOR RESIDUE PO4 A 3322

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2Z22)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2Z22)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2Z22)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2Z22)

(-) Exons   (0, 0)

(no "Exon" information available for 2Z22)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:321
 aligned with Q7CFM9_YERPE | Q7CFM9 from UniProtKB/TrEMBL  Length:346

    Alignment length:321
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345 
         Q7CFM9_YERPE    26 AASLTGAGATFPAPVYAKWADSYQKETGNKINYQGIGSSGGVKQIIANTVDFGASDAPLTDEKLATEGLFQFPTVIGGVVLAVNIPGIKSGELTLDGKTLGDIYLGTVKKWNDPAIVKLNPGVKLPDQNIAVVRRADGSGTSFVFTSYLAKVNAEWKEKVGAGSTVNWPTGLGGKGNDGIAAFVQRLPGSIGYVEYAYAKQNNLAYTKLISADGKPVSPTEHSFSSAAKGVDWSKSFAQDLTNQKGDDVWPITSTTFILVHKEQKNAANGTEVLKFFDWGYTHGAKQANELDYATLPAEVVEQVRAAWKTQIKDSSGKPIF 346
               SCOP domains d2z22a_ A: automated matches                                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains 2z22A01 A:1-77,A:230-239,A:254-321 Periplasmic binding protein-like II       2z22A02 A:78-229,A:240-253 Periplasmic binding protein-like II                                                                                          2z22A01   2z22A02       2z22A01 A:1-77,A:230-239,A:254-321                                   CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee...hhhhhhhhhhhhhhhhh.eeeeee.hhhhhhhhhhh....eeee....hhhhhhhhheeeeeeeeeeeeeee..........eehhhhhhhhhh.......hhhhhhhh..........eeeee...hhhhhhhhhhhhhhhhhhhhhh...........eeehhhhhhhhhhhhh..eeeeeehhhhhh...ee.eee.....ee..hhhhhhhh.........................eeeeeeeee.ee.hhhhhhhhhhhhhhhhhhhhhhhhhh..ee.hhhhhhhhhhhhhhhhee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2z22 A   1 EASLTGAGATFPAPVYAKWADSYQKETGNKINYQGIGSSGGVKQIIANTVDFGASDAPLTDEKLATEGLFQFPTVIGGVVLAVNIPGIKSGELTLDGKTLGDIYLGTVKKWNDPAIVKLNPGVKLPDQNIAVVRRADGSGTSFVFTSYLAKVNAEWKEKVGAGSTVNWPTGLGGKGNDGIAAFVQRLPGSIGYVEYAYAKQNNLAYTKLISADGKPVSPTEHSFSSAAKGVDWSKSFAQDLTNQKGDDVWPITSTTFILVHKEQKNAANGTEVLKFFDWGYTHGAKQANELDYATLPAEVVEQVRAAWKTQIKDSSGKPIF 321
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320 


Chain X from PDB  Type:PROTEIN  Length:321
 aligned with Q7CFM9_YERPE | Q7CFM9 from UniProtKB/TrEMBL  Length:346

    Alignment length:321
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345 
         Q7CFM9_YERPE    26 AASLTGAGATFPAPVYAKWADSYQKETGNKINYQGIGSSGGVKQIIANTVDFGASDAPLTDEKLATEGLFQFPTVIGGVVLAVNIPGIKSGELTLDGKTLGDIYLGTVKKWNDPAIVKLNPGVKLPDQNIAVVRRADGSGTSFVFTSYLAKVNAEWKEKVGAGSTVNWPTGLGGKGNDGIAAFVQRLPGSIGYVEYAYAKQNNLAYTKLISADGKPVSPTEHSFSSAAKGVDWSKSFAQDLTNQKGDDVWPITSTTFILVHKEQKNAANGTEVLKFFDWGYTHGAKQANELDYATLPAEVVEQVRAAWKTQIKDSSGKPIF 346
               SCOP domains d2z22x_ X: automated matches                                                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains 2z22X01 X:1-77,X:230-239,X:254-321 Periplasmic binding protein-like II       2z22X02 X:78-229,X:240-253 Periplasmic binding protein-like II                                                                                          2z22X01   2z22X02       2z22X01 X:1-77,X:230-239,X:254-321                                   CATH domains
           Pfam domains (1) -PBP_like_2-2z22X01 X:2-283                                                                                                                                                                                                                                                                -------------------------------------- Pfam domains (1)
           Pfam domains (2) -PBP_like_2-2z22X02 X:2-283                                                                                                                                                                                                                                                                -------------------------------------- Pfam domains (2)
         Sec.struct. author ..eeeeee...hhhhhhhhhhhhhhhhh.eeeeee.hhhhhhhhhhh....eeee....hhhhhhhhheeeeeeeeeeeeeee..........eehhhhhhhhhh.......hhhhhhhh..........eeeee...hhhhhhhhhhhhhhhhhhhhhh...........eeehhhhhhhhhhhhh..eeeeeehhhhhhh..ee.eee.....ee..hhhhhhhhh........................eeeeeeeee.ee.hhhhhhhhhhhhhhhhhhhhhhhhhh..ee.hhhhhhhhhhhhhhhhee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2z22 X   1 EASLTGAGATFPAPVYAKWADSYQKETGNKINYQGIGSSGGVKQIIANTVDFGASDAPLTDEKLATEGLFQFPTVIGGVVLAVNIPGIKSGELTLDGKTLGDIYLGTVKKWNDPAIVKLNPGVKLPDQNIAVVRRADGSGTSFVFTSYLAKVNAEWKEKVGAGSTVNWPTGLGGKGNDGIAAFVQRLPGSIGYVEYAYAKQNNLAYTKLISADGKPVSPTEHSFSSAAKGVDWSKSFAQDLTNQKGDDVWPITSTTFILVHKEQKNAANGTEVLKFFDWGYTHGAKQANELDYATLPAEVVEQVRAAWKTQIKDSSGKPIF 321
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: PBP (391)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A,X   (Q7CFM9_YERPE | Q7CFM9)
molecular function
    GO:0042301    phosphate ion binding    Interacting selectively and non-covalently with phosphate.
biological process
    GO:0035435    phosphate ion transmembrane transport    The directed movement of phosphate across a membrane by means of some agent such as a transporter or pore.
    GO:0006817    phosphate ion transport    The directed movement of phosphate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0043190    ATP-binding cassette (ABC) transporter complex    A complex for the transport of metabolites into and out of the cell, typically comprised of four domains; two membrane-associated domains and two ATP-binding domains at the intracellular face of the membrane, that form a central pore through the plasma membrane. Each of the four core domains may be encoded as a separate polypeptide or the domains can be fused in any one of a number of ways into multidomain polypeptides. In Bacteria and Archaebacteria, ABC transporters also include substrate binding proteins to bind substrate external to the cytoplasm and deliver it to the transporter.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2z22)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2z22
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q7CFM9_YERPE | Q7CFM9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q7CFM9_YERPE | Q7CFM9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2Z22)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2Z22)