|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2Z17) |
Sites (0, 0)| (no "Site" information available for 2Z17) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2Z17) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2Z17) |
SAPs(SNPs)/Variants (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2Z17) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:94 aligned with CYTIP_HUMAN | O60759 from UniProtKB/Swiss-Prot Length:359 Alignment length:94 79 89 99 109 119 129 139 149 159 CYTIP_HUMAN 70 FSWSQRKLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTEGFTYKQVVDLIRSSGNLLTIETL 163 SCOP domains d2z17a_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------- CATH domains Pfam domains -------PDZ-2z17A01 A:18-104 Pfam domains SAPs(SNPs) -------------E-------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------PDZ PDB: A:18-104 UniProt: 77-166 PROSITE Transcript ---------------------------------------------------------------------------------------------- Transcript 2z17 A 11 FSWSQRKLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTEGFTYKQVVDLIRSSGNLLTIETL 104 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2Z17) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A (CYTIP_HUMAN | O60759)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|