2Z0I - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:283
 aligned with HEM2_MOUSE | P10518 from UniProtKB/Swiss-Prot  Length:330

    Alignment length:323
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325   
           HEM2_MOUSE     6 VLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEMLRPLVEAGLRCVLIFGVPSRVPKDEQGSAADSEDSPTIEAVRLLRKTFPSLLVACDVCLCPYTSHGHCGLLSENGAFLAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKAALLKHGLGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVARDIQEGADMLMVKPGLPYLDMVREVKDKHPELPLAVYQVSGEFAMLWHGAQAGAFDLRTAVLETMTAFRRAGADIIITYFAPQLLKWLK 328
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2z0iA00 A:6-328 Aldolase class I                                                                                                                                                                                                                                                                                                    CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.hhhhhhhhh.....hhhh.eeeeeee.....eee.......eeee..hhhhhhhhhhh....eeeeeee...------------..hhhhhhhhhhhhhh...eeee....------------------.hhhhhhhhhhhhhhhhhhh..ee.......hhhhhhhhhhhh.......ee....ee.....hhhhhhhh.----------......hhhhhhhhhhhhhhhh...eeee.hhhhhhhhhhhhhhh....eeee.hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh...eee..hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D_ALA_DEHYDRA----------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2z0i A   6 VLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEmLRPLVEAGLRCVLIFGVPSR------------EDSPTIEAVRLLRKTFPSLLVACDVCL------------------LSEESRQRLAEVALAYAKAGCQVVAPSDmmDGRVEAIKAALLKHGLGNRVSVmSYSAKFASCFYGPFRDAAQ----------YQLPPGARGLALRAVARDIQEGADmLmVKPGLPYLDmVREVKDKHPELPLAVYQVSGEFAmLWHGAQAGAFDLRTAVLETmTAFRRAGADIIITYFAPQLLKWLK 328
                                    15        25        35        45        55        65        75        |-         - |     105       115       | -         -      |145       155       165    || 175       185       195       205       | -       225       235       245  | |  255    |  265       275       285       295       305       315       325   
                                                                                     64-MSE              84           97                       123                142                         170-MSE                 194-MSE            213        224                     248-MSE     260-MSE                 284-MSE             304-MSE                    
                                                                                                                                                                                               171-MSE                                                                        250-MSE

Chain A from PDB  Type:PROTEIN  Length:283
 aligned with Q9DD05_MOUSE | Q9DD05 from UniProtKB/TrEMBL  Length:330

    Alignment length:323
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325   
         Q9DD05_MOUSE     6 VLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEMLRPLVEAGLRCVLIFGVPSRVPKDEQGSAADSEDSPTIEAVRLLRKTFPSLLVACDVCLCPYTSHGHCGLLSENGAFLSEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKAALLKHGLGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVARDIQEGADMLMVKPGLPYLDMVREVKDKHPELPLAVYQVSGEFAMLWHGAQAGAFDLRTAVLETMTAFRRAGADIIITYFAPQLLKWLK 328
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2z0iA00 A:6-328 Aldolase class I                                                                                                                                                                                                                                                                                                    CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh.hhhhhhhhh.....hhhh.eeeeeee.....eee.......eeee..hhhhhhhhhhh....eeeeeee...------------..hhhhhhhhhhhhhh...eeee....------------------.hhhhhhhhhhhhhhhhhhh..ee.......hhhhhhhhhhhh.......ee....ee.....hhhhhhhh.----------......hhhhhhhhhhhhhhhh...eeee.hhhhhhhhhhhhhhh....eeee.hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh...eee..hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2z0i A   6 VLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEmLRPLVEAGLRCVLIFGVPSR------------EDSPTIEAVRLLRKTFPSLLVACDVCL------------------LSEESRQRLAEVALAYAKAGCQVVAPSDmmDGRVEAIKAALLKHGLGNRVSVmSYSAKFASCFYGPFRDAAQ----------YQLPPGARGLALRAVARDIQEGADmLmVKPGLPYLDmVREVKDKHPELPLAVYQVSGEFAmLWHGAQAGAFDLRTAVLETmTAFRRAGADIIITYFAPQLLKWLK 328
                                    15        25        35        45        55        65        75        |-         - |     105       115       | -         -      |145       155       165    || 175       185       195       205       | -       225       235       245  | |  255    |  265       275       285       295       305       315       325   
                                                                                     64-MSE              84           97                       123                142                         170-MSE                 194-MSE            213        224                     248-MSE     260-MSE                 284-MSE             304-MSE                    
                                                                                                                                                                                               171-MSE                                                                        250-MSE

Chain B from PDB  Type:PROTEIN  Length:276
 aligned with HEM2_MOUSE | P10518 from UniProtKB/Swiss-Prot  Length:330

    Alignment length:323
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325   
           HEM2_MOUSE     6 VLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEMLRPLVEAGLRCVLIFGVPSRVPKDEQGSAADSEDSPTIEAVRLLRKTFPSLLVACDVCLCPYTSHGHCGLLSENGAFLAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKAALLKHGLGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVARDIQEGADMLMVKPGLPYLDMVREVKDKHPELPLAVYQVSGEFAMLWHGAQAGAFDLRTAVLETMTAFRRAGADIIITYFAPQLLKWLK 328
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2z0iB00 B:6-328 Aldolase class I                                                                                                                                                                                                                                                                                                    CATH domains
           Pfam domains (1) ALAD-2z0iB01 B:6-327                                                                                                                                                                                                                                                                                                              - Pfam domains (1)
           Pfam domains (2) ALAD-2z0iB02 B:6-327                                                                                                                                                                                                                                                                                                              - Pfam domains (2)
         Sec.struct. author .hhhhh.hhhhhhhh......hhh.eeeeeeee.....eee.......eeee...hhhhhhhhhhhh..eeeeee..-------------...hhhhhhhhhhhhhh...eeeeee..-------------------hhhhhhhhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhhhhhhhhee....ee.........---------------......hhhhhhhhhhhhhhh....eeee.hhhhhhhhhhhhhhh....eeee.hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..eee..hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D_ALA_DEHYDRA----------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2z0i B   6 VLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEmLRPLVEAGLRCVLIFGVP-------------SEDSPTIEAVRLLRKTFPSLLVACDVCL-------------------SEESRQRLAEVALAYAKAGCQVVAPSDmmDGRVEAIKAALLKHGLGNRVSVmSYSAKFASCFYGPF---------------YQLPPGARGLALRAVARDIQEGADmLmVKPGLPYLDmVREVKDKHPELPLAVYQVSGEFAmLWHGAQAGAFDLRTAVLETmTAFRRAGADIIITYFAPQLLKWLK 328
                                    15        25        35        45        55        65        75      |  -         -|      105       115       | -         -       145       155       165    || 175       185       195       205  |      -       225       235       245  | |  255    |  265       275       285       295       305       315       325   
                                                                                     64-MSE            82            96                        123                 143                        170-MSE                 194-MSE       208             224                     248-MSE     260-MSE                 284-MSE             304-MSE                    
                                                                                                                                                                                               171-MSE                                                                        250-MSE

Chain B from PDB  Type:PROTEIN  Length:276
 aligned with Q9DD05_MOUSE | Q9DD05 from UniProtKB/TrEMBL  Length:330

    Alignment length:323
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325   
         Q9DD05_MOUSE     6 VLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEMLRPLVEAGLRCVLIFGVPSRVPKDEQGSAADSEDSPTIEAVRLLRKTFPSLLVACDVCLCPYTSHGHCGLLSENGAFLSEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKAALLKHGLGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVARDIQEGADMLMVKPGLPYLDMVREVKDKHPELPLAVYQVSGEFAMLWHGAQAGAFDLRTAVLETMTAFRRAGADIIITYFAPQLLKWLK 328
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2z0iB00 B:6-328 Aldolase class I                                                                                                                                                                                                                                                                                                    CATH domains
           Pfam domains (1) ALAD-2z0iB01 B:6-327                                                                                                                                                                                                                                                                                                              - Pfam domains (1)
           Pfam domains (2) ALAD-2z0iB02 B:6-327                                                                                                                                                                                                                                                                                                              - Pfam domains (2)
         Sec.struct. author .hhhhh.hhhhhhhh......hhh.eeeeeeee.....eee.......eeee...hhhhhhhhhhhh..eeeeee..-------------...hhhhhhhhhhhhhh...eeeeee..-------------------hhhhhhhhhhhhhhhhhhh..eeee.....hhhhhhhhhhhhhhhhhhhee....ee.........---------------......hhhhhhhhhhhhhhh....eeee.hhhhhhhhhhhhhhh....eeee.hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..eee..hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2z0i B   6 VLHSGYFHPLLRSWQTAASTVSASNLIYPIFVTDVPDDVQPIASLPGVARYGVNQLEEmLRPLVEAGLRCVLIFGVP-------------SEDSPTIEAVRLLRKTFPSLLVACDVCL-------------------SEESRQRLAEVALAYAKAGCQVVAPSDmmDGRVEAIKAALLKHGLGNRVSVmSYSAKFASCFYGPF---------------YQLPPGARGLALRAVARDIQEGADmLmVKPGLPYLDmVREVKDKHPELPLAVYQVSGEFAmLWHGAQAGAFDLRTAVLETmTAFRRAGADIIITYFAPQLLKWLK 328
                                    15        25        35        45        55        65        75      |  -         -|      105       115       | -         -       145       155       165    || 175       185       195       205  |      -       225       235       245  | |  255    |  265       275       285       295       305       315       325   
                                                                                     64-MSE            82            96                        123                 143                        170-MSE                 194-MSE       208             224                     248-MSE     260-MSE                 284-MSE             304-MSE                    
                                                                                                                                                                                               171-MSE                                                                        250-MSE

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,B (HEM2_MOUSE | P10518)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0032791	lead ion binding	Interacting selectively and non-covalently with lead (Pb) ions.
	GO:0016829	lyase activity	Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004655	porphobilinogen synthase activity	Catalysis of the reaction: 2 5-aminolevulinate = 2 H(2)O + H(+) + porphobilinogen.
	GO:0008270	zinc ion binding	Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
	GO:0071353	cellular response to interleukin-4	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-4 stimulus.
	GO:0071284	cellular response to lead ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lead ion stimulus.
	GO:0006783	heme biosynthetic process	The chemical reactions and pathways resulting in the formation of heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring, from less complex precursors.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0006779	porphyrin-containing compound biosynthetic process	The chemical reactions and pathways resulting in the formation of any member of a large group of derivatives or analogs of porphyrin. Porphyrin consists of a ring of four pyrrole nuclei linked each to the next at their alpha positions through a methine group.
	GO:0051260	protein homooligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of identical component monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0006782	protoporphyrinogen IX biosynthetic process	The chemical reactions and pathways resulting in the formation of protoporphyrinogen IX.
	GO:0014823	response to activity	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an activity stimulus.
	GO:0010044	response to aluminum ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an aluminum ion stimulus.
	GO:0043200	response to amino acid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups.
	GO:0046685	response to arsenic-containing substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an arsenic stimulus from compounds containing arsenic, including arsenates, arsenites, and arsenides.
	GO:0046686	response to cadmium ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cadmium (Cd) ion stimulus.
	GO:0032025	response to cobalt ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cobalt ion stimulus.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0045471	response to ethanol	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an ethanol stimulus.
	GO:0070542	response to fatty acid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a fatty acid stimulus.
	GO:0051384	response to glucocorticoid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucocorticoid stimulus. Glucocorticoids are hormonal C21 corticosteroids synthesized from cholesterol with the ability to bind with the cortisol receptor and trigger similar effects. Glucocorticoids act primarily on carbohydrate and protein metabolism, and have anti-inflammatory effects.
	GO:0009635	response to herbicide	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a herbicide stimulus. Herbicides are chemicals used to kill or control the growth of plants.
	GO:0009725	response to hormone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hormone stimulus.
	GO:0001666	response to hypoxia	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
	GO:0010035	response to inorganic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an inorganic substance stimulus.
	GO:0010212	response to ionizing radiation	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a ionizing radiation stimulus. Ionizing radiation is radiation with sufficient energy to remove electrons from atoms and may arise from spontaneous decay of unstable isotopes, resulting in alpha and beta particles and gamma rays. Ionizing radiation also includes X-rays.
	GO:0010039	response to iron ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an iron ion stimulus.
	GO:0010288	response to lead ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lead ion stimulus.
	GO:0032496	response to lipopolysaccharide	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0046689	response to mercury ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mercury ion stimulus.
	GO:0010038	response to metal ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a metal ion stimulus.
	GO:0051597	response to methylmercury	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a methylmercury stimulus.
	GO:0007584	response to nutrient	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nutrient stimulus.
	GO:0031667	response to nutrient levels	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus reflecting the presence, absence, or concentration of nutrients.
	GO:0014070	response to organic cyclic compound	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
	GO:0010033	response to organic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
	GO:0006979	response to oxidative stress	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
	GO:0070541	response to platinum ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a platinum stimulus.
	GO:0010269	response to selenium ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from selenium ion.
	GO:0009636	response to toxic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a toxic stimulus.
	GO:0033273	response to vitamin	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a vitamin stimulus.
	GO:0010266	response to vitamin B1	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a vitamin B1 stimulus.
	GO:0033197	response to vitamin E	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a vitamin E stimulus.
	GO:0010043	response to zinc ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a zinc ion stimulus.
	GO:0033014	tetrapyrrole biosynthetic process	The chemical reactions and pathways leading to the formation of tetrapyrroles, natural pigments containing four pyrrole rings joined by one-carbon units linking position 2 of one pyrrole ring to position 5 of the next.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain A,B (Q9DD05_MOUSE | Q9DD05)

molecular function
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0016829	lyase activity	Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004655	porphobilinogen synthase activity	Catalysis of the reaction: 2 5-aminolevulinate = 2 H(2)O + H(+) + porphobilinogen.
biological process
	GO:0006779	porphyrin-containing compound biosynthetic process	The chemical reactions and pathways resulting in the formation of any member of a large group of derivatives or analogs of porphyrin. Porphyrin consists of a ring of four pyrrole nuclei linked each to the next at their alpha positions through a methine group.
	GO:0033014	tetrapyrrole biosynthetic process	The chemical reactions and pathways leading to the formation of tetrapyrroles, natural pigments containing four pyrrole rings joined by one-carbon units linking position 2 of one pyrrole ring to position 5 of the next.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 18)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (52, 58)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File