Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PHOSPHORIBOSYLAMINOIMIDAZOLE SYNTHETASE FROM GEOBACILLUS KAUSTOPHILUS
 
Authors :  M. Kanagawa, S. Baba, S. Kuramitsu, S. Yokoyama, G. Kawai, G. Sampei, Ri Structural Genomics/Proteomics Initiative (Rsgi)
Date :  06 May 07  (Deposition) - 06 Nov 07  (Release) - 25 Nov 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  A  (2x)
Keywords :  Alpha And Beta Proteins, Ligase, Purine Biosynthesis, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Kanagawa, S. Baba, Y. Watanabe, N. Nakagawa, A. Ebihara, S. Kuramitsu, S. Yokoyama, G. Sampei, G. Kawai
Crystal Structures And Ligand Binding Of Purm Proteins From Thermus Thermophilus And Geobacillus Kaustophilus
J. Biochem. 2015
PubMed-ID: 26515187  |  Reference-DOI: 10.1093/JB/MVV107

(-) Compounds

Molecule 1 - PHOSPHORIBOSYLFORMYLGLYCINAMIDINE CYCLO-LIGASE
    ChainsA
    EC Number6.3.3.1
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-HISTEV
    Expression System Taxid562
    Expression System Vector TypePLASMID
    Organism ScientificGEOBACILLUS KAUSTOPHILUS
    Organism Taxid1462
    SynonymAIRS, PHOSPHORIBOSYL-AMINOIMIDAZOLE SYNTHETASE, AIR SYNTHASE

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit A
Biological Unit 1 (1x)A
Biological Unit 2 (2x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2Z01)

(-) Sites  (0, 0)

(no "Site" information available for 2Z01)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2Z01)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Glu A:211 -Pro A:212

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2Z01)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2Z01)

(-) Exons   (0, 0)

(no "Exon" information available for 2Z01)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:313
 aligned with PUR5_GEOKA | Q5L3D0 from UniProtKB/Swiss-Prot  Length:346

    Alignment length:326
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336      
           PUR5_GEOKA    17 QAVALMKEHVQKTMRPEVLGGIGGFGGLFDLSALGYRQPVLISGTDGVGTKLKLAFLLDRHDTIGIDCVAMCVNDIIVQGAEPLFFLDYIACGKAVPEKIAAIVKGVADGCVEAGCALIGGETAEMPGMYDEDEYDLAGFAVGVAEKERLITGETIQAGDALVGLPSSGLHSNGYSLVRRIVFEQAKLSLDEIYEPLDVPLGEELLKPTRIYAKLLRSVRERFTIKGMAHITGGGLIENIPRMLPPGIGARIQLGSWPILPIFDFLREKGSLEEEEMFSVFNMGIGLVLAVSPETAAPLVEWLSERGEPAYIIGEVAKGAGVSFAG 342
               SCOP domains d2z01a1 A:17-167 aut     omated matches                                                                                                                d2z01a2 A:168-342 automated matches                                                                                                                                             SCOP domains
               CATH domains 2z01A01 A:17-167  [c     ode=3.30.1330.10, no name defined]                                                                                            2z01A02 A:168-342 Phosphoribosyl-aminoimidazole Synthetase; Chain A, domain 2                                                                                                   CATH domains
               Pfam domains AIRS-2z01A01 A:17-13     9                                                                                                 --        -----------------------AIRS_C-2z01A02 A:173-341                                                                                                                                                 - Pfam domains
         Sec.struct. author hhhhhhhhhhhhhh...ee.-----..ee.hhhhh...eeeeeeeee..hhhhhhhhhh...hhhhhhhhhhhhhhhh...eeeeeeeeeee...hhhhhhhhhhhhhhhhhhhh.eeee..ee.--------.eeeeeeeeeeee.hhh..........eeeeee.......hhhhhhhhhhh...............hhhhhhhh....hhhhhhhhhhhh...eeee...hhhhhhhhhhh...eeeeee......hhhhhhhhhhh..hhhhhhhhh...eeeeeeehhhhhhhhhhhhhhh....eeeeeeee..eeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2z01 A  17 QAVALMKEHVQKTMRPEVLG-----GGLFDLSALGYRQPVLISGTDGVGTKLKLAFLLDRHDTIGIDCVAMCVNDIIVQGAEPLFFLDYIACGKAVPEKIAAIVKGVADGCVEAGCALIGGETAE--------EYDLAGFAVGVAEKERLITGETIQAGDALVGLPSSGLHSNGYSLVRRIVFEQAKLSLDEIYEPLDVPLGEELLKPTRIYAKLLRSVRERFTIKGMAHITGGGLIENIPRMLPPGIGARIQLGSWPILPIFDFLREKGSLEEEEMFSVFNMGIGLVLAVSPETAAPLVEWLSERGEPAYIIGEVAKGAGVSFAG 342
                                    26        36     |  46        56        66        76        86        96       106       116       126       136    |    -   |   156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336      
                                              36    42                                                                                                141      150                                                                                                                                                                                                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric Unit

(-) CATH Domains  (2, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (2, 2)

Asymmetric Unit

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)
Chain A   (PUR5_GEOKA | Q5L3D0)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016874    ligase activity    Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0004641    phosphoribosylformylglycinamidine cyclo-ligase activity    Catalysis of the reaction: 2-(formamido)-N(1)-(5-phospho-D-ribosyl)acetamidine + ATP = 5-amino-1-(5-phospho-D-ribosyl)imidazole + ADP + 2 H(+) + phosphate.
biological process
    GO:0006189    'de novo' IMP biosynthetic process    The chemical reactions and pathways resulting in the formation of IMP, inosine monophosphate, by the stepwise assembly of a purine ring on ribose 5-phosphate.
    GO:0006164    purine nucleotide biosynthetic process    The chemical reactions and pathways resulting in the formation of a purine nucleotide, a compound consisting of nucleoside (a purine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2z01)
 
  Sites
(no "Sites" information available for 2z01)
 
  Cis Peptide Bonds
    Glu A:211 - Pro A:212   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2z01
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PUR5_GEOKA | Q5L3D0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  6.3.3.1
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PUR5_GEOKA | Q5L3D0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2Z01)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2Z01)