Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE Y65A MUTANT OF TETRAHEME CYTOCHROME C3 FROM DESULFOVIBRIO VULGARIS MIYAZAKI F
 
Authors :  Y. Higuchi, H. Komori
Date :  02 May 07  (Deposition) - 06 May 08  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.00
Chains :  Asym./Biol. Unit :  A
Keywords :  Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Takayama, H. Komori, K. Morita, Y. Higuchi, H. Akutsu
Structures Of Noncoordinated Aromatic Residue Mutants In Tetraheme Cytochrome C3 From Desulfovibrio Vulgaris Miyazaki F
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CYTOCHROME C3
    ChainsA
    EngineeredYES
    Expression SystemSHEWANELLA ONEIDENSIS
    Expression System PlasmidPKF19K
    Expression System StrainTSP-C
    Expression System Taxid70863
    Expression System Vector TypePLASMID
    MutationYES
    Organism ScientificDESULFOVIBRIO VULGARIS STR. 'MIYAZAKI F'
    Organism Taxid883
    StrainMIYAZAKI F

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
1HEM4Ligand/IonPROTOPORPHYRIN IX CONTAINING FE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREMET A:11 , ASP A:12 , LYS A:13 , THR A:14 , GLN A:16 , PRO A:17 , GLY A:39 , TYR A:66 , HIS A:70 , CYS A:79 , HIS A:83 , LEU A:97 , THR A:98 , GLY A:99 , CYS A:100 , CYS A:105 , HIS A:106 , HOH A:1013 , HOH A:1019 , HOH A:1033 , HOH A:1062 , HOH A:1249BINDING SITE FOR RESIDUE HEM A 1004
2AC2SOFTWAREHIS A:35 , ASP A:42 , GLN A:44 , LYS A:45 , CYS A:46 , CYS A:51 , HIS A:52 , HIS A:67 , ALA A:68 , THR A:74 , LYS A:75 , PHE A:76 , HOH A:1021 , HOH A:1041 , HOH A:1063 , HOH A:1065 , HOH A:1107BINDING SITE FOR RESIDUE HEM A 1002
3AC3SOFTWAREPRO A:2 , LYS A:3 , ALA A:4 , PRO A:5 , LEU A:9 , MET A:11 , PHE A:20 , HIS A:22 , HIS A:25 , CYS A:30 , CYS A:33 , HIS A:34 , TYR A:43 , LYS A:45 , CYS A:46 , HOH A:1032 , HOH A:1081 , HOH A:1093 , HOH A:1102 , HOH A:1113 , HOH A:1185BINDING SITE FOR RESIDUE HEM A 1001
4AC4SOFTWAREASN A:21 , THR A:24 , HIS A:25 , CYS A:79 , CYS A:82 , HIS A:83 , LYS A:93 , LYS A:104 , HOH A:1008 , HOH A:1051 , HOH A:1095 , HOH A:1129 , HOH A:1157 , HOH A:1203 , HOH A:1212 , HOH A:1243BINDING SITE FOR RESIDUE HEM A 1003

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2YYX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2YYX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2YYX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2YYX)

(-) Exons   (0, 0)

(no "Exon" information available for 2YYX)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:107
 aligned with CYC3_DESVM | P00132 from UniProtKB/Swiss-Prot  Length:130

    Alignment length:107
                                    33        43        53        63        73        83        93       103       113       123       
           CYC3_DESVM    24 APKAPADGLKMDKTKQPVVFNHSTHKAVKCGDCHHPVNGKEDYQKCATAGCHDNMDKKDKSAKGYYHAMHDKGTKFKSCVGCHLETAGADAAKKKELTGCKGSKCHS 130
               SCOP domains d2yyxa_ A: Cytochrome c3                                                                                    SCOP domains
               CATH domains 2yyxA00 A:1-107 Cytochrome C3                                                                               CATH domains
               Pfam domains Cytochrom_CIII-2yyxA01 A:1-106                                                                            - Pfam domains
         Sec.struct. author ........eee......eee.hhhhh..hhhhhh.ee..ee......................hhhhhhhh......hhhhhhhhhhh.hhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------- Transcript
                 2yyx A   1 APKAPADGLKMDKTKQPVVFNHSTHKAVKCGDCHHPVNGKEDYQKCATAGCHDNMDKKDKSAKGAYHAMHDKGTKFKSCVGCHLETAGADAAKKKELTGCKGSKCHS 107
                                    10        20        30        40        50        60        70        80        90       100       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (CYC3_DESVM | P00132)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0009061    anaerobic respiration    The enzymatic release of energy from inorganic and organic compounds (especially carbohydrates and fats) which uses compounds other than oxygen (e.g. nitrate, sulfate) as the terminal electron acceptor.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2yyx)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2yyx
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CYC3_DESVM | P00132
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CYC3_DESVM | P00132
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CYC3_DESVM | P001321it1 1j0o 1j0p 1wr5 2cdv 2ewi 2ewk 2ewu 2ffn 2yxc 2yyw 2z47

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2YYX)