2YVQ - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF MGS DOMAIN OF CARBAMOYL-PHOSPHATE SYNTHETASE FROM HOMO SAPIENS

Authors :   Y. Xie, Ihsanawati, S. Kishishita, K. Murayama, C. Takemoto, M. Shirozu, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   13 Apr 07 (Deposition) - 15 Apr 08 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.98

Chains :   Asym. Unit : A
Biol. Unit 1: A  (1x)
Biol. Unit 2: A  (2x)

Keywords :   Conserved Hypothetical Protein, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Ligase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Xie, Ihsanawati, S. Kishishita, K. Murayama, C. Takemoto, M. Shirozu, S. Yokoyama
Crystal Structure Of Mgs Domain Of Carbamoyl-Phosphate Synthetase From Homo Sapiens
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - CARBAMOYL-PHOSPHATE SYNTHASE
	Chains	:	A
	EC Number	:	6.3.4.16
	Engineered	:	YES
	Expression System Plasmid	:	PK060110-54-MD01
	Expression System Vector Type	:	PLASMID
	Fragment	:	MGS DOMAIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS
	Synonym	:	CARBAMOYL-PHOSPHATE SYNTHETASE I, CPSASE I

		1
Asymmetric Unit	:	A
Biological Unit 1 (1x)	:	A
Biological Unit 2 (2x)	:	A

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2YVQ)

(no "Site" information available for 2YVQ)

(no "SS Bond" information available for 2YVQ)

(no "Cis Peptide Bond" information available for 2YVQ)

Asymmetric Unit (13, 13)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_066137	R	1371	L	CPSM_HUMAN	Disease (CPS1D)	---	A	R	1371	L
02	UniProt	VAR_017568	G	1376	S	CPSM_HUMAN	Polymorphism	140578009	A	G	1376	S
03	UniProt	VAR_066169	A	1378	T	CPSM_HUMAN	Disease (CPS1D)	---	A	A	1378	T
04	UniProt	VAR_075413	L	1381	S	CPSM_HUMAN	Disease (CPS1D)	---	A	L	1381	S
05	UniProt	VAR_066138	T	1391	M	CPSM_HUMAN	Disease (CPS1D)	---	A	T	1391	M
06	UniProt	VAR_066139	L	1398	V	CPSM_HUMAN	Disease (CPS1D)	---	A	L	1398	V
07	UniProt	VAR_017569	T	1406	N	CPSM_HUMAN	Polymorphism	1047891	A	T	1406	N
08	UniProt	VAR_064066	P	1411	L	CPSM_HUMAN	Disease (CPS1D)	---	A	P	1411	L
09	UniProt	VAR_066140	P	1439	L	CPSM_HUMAN	Disease (CPS1D)	---	A	P	1439	L
10	UniProt	VAR_066170	T	1443	A	CPSM_HUMAN	Disease (CPS1D)	---	A	T	1443	A
11	UniProt	VAR_064067	R	1453	Q	CPSM_HUMAN	Disease (CPS1D)	---	A	R	1453	Q
12	UniProt	VAR_064068	R	1453	W	CPSM_HUMAN	Disease (CPS1D)	---	A	R	1453	W
13	UniProt	VAR_066141	P	1462	R	CPSM_HUMAN	Disease (CPS1D)	---	A	P	1462	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (13, 13)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_066137	R	1371	L	CPSM_HUMAN	Disease (CPS1D)	---	A	R	1371	L
02	UniProt	VAR_017568	G	1376	S	CPSM_HUMAN	Polymorphism	140578009	A	G	1376	S
03	UniProt	VAR_066169	A	1378	T	CPSM_HUMAN	Disease (CPS1D)	---	A	A	1378	T
04	UniProt	VAR_075413	L	1381	S	CPSM_HUMAN	Disease (CPS1D)	---	A	L	1381	S
05	UniProt	VAR_066138	T	1391	M	CPSM_HUMAN	Disease (CPS1D)	---	A	T	1391	M
06	UniProt	VAR_066139	L	1398	V	CPSM_HUMAN	Disease (CPS1D)	---	A	L	1398	V
07	UniProt	VAR_017569	T	1406	N	CPSM_HUMAN	Polymorphism	1047891	A	T	1406	N
08	UniProt	VAR_064066	P	1411	L	CPSM_HUMAN	Disease (CPS1D)	---	A	P	1411	L
09	UniProt	VAR_066140	P	1439	L	CPSM_HUMAN	Disease (CPS1D)	---	A	P	1439	L
10	UniProt	VAR_066170	T	1443	A	CPSM_HUMAN	Disease (CPS1D)	---	A	T	1443	A
11	UniProt	VAR_064067	R	1453	Q	CPSM_HUMAN	Disease (CPS1D)	---	A	R	1453	Q
12	UniProt	VAR_064068	R	1453	W	CPSM_HUMAN	Disease (CPS1D)	---	A	R	1453	W
13	UniProt	VAR_066141	P	1462	R	CPSM_HUMAN	Disease (CPS1D)	---	A	P	1462	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (13, 26)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_066137	R	1371	L	CPSM_HUMAN	Disease (CPS1D)	---	A	R	1371	L
02	UniProt	VAR_017568	G	1376	S	CPSM_HUMAN	Polymorphism	140578009	A	G	1376	S
03	UniProt	VAR_066169	A	1378	T	CPSM_HUMAN	Disease (CPS1D)	---	A	A	1378	T
04	UniProt	VAR_075413	L	1381	S	CPSM_HUMAN	Disease (CPS1D)	---	A	L	1381	S
05	UniProt	VAR_066138	T	1391	M	CPSM_HUMAN	Disease (CPS1D)	---	A	T	1391	M
06	UniProt	VAR_066139	L	1398	V	CPSM_HUMAN	Disease (CPS1D)	---	A	L	1398	V
07	UniProt	VAR_017569	T	1406	N	CPSM_HUMAN	Polymorphism	1047891	A	T	1406	N
08	UniProt	VAR_064066	P	1411	L	CPSM_HUMAN	Disease (CPS1D)	---	A	P	1411	L
09	UniProt	VAR_066140	P	1439	L	CPSM_HUMAN	Disease (CPS1D)	---	A	P	1439	L
10	UniProt	VAR_066170	T	1443	A	CPSM_HUMAN	Disease (CPS1D)	---	A	T	1443	A
11	UniProt	VAR_064067	R	1453	Q	CPSM_HUMAN	Disease (CPS1D)	---	A	R	1453	Q
12	UniProt	VAR_064068	R	1453	W	CPSM_HUMAN	Disease (CPS1D)	---	A	R	1453	W
13	UniProt	VAR_066141	P	1462	R	CPSM_HUMAN	Disease (CPS1D)	---	A	P	1462	R

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2YVQ)

(no "Exon" information available for 2YVQ)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:134
 aligned with CPSM_HUMAN | P31327 from UniProtKB/Swiss-Prot  Length:1500

    Alignment length:140
                                  1348      1358      1368      1378      1388      1398      1408      1418      1428      1438      1448      1458      1468      1478
          CPSM_HUMAN   1339 GEGIHTAFLKAMLSTGFKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQ 1478
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --- ------------------------------MGS-2yvqA01 A:1373-1465                                                                      ------------- Pfam domains
         Sec.struct. author ...-hhhhhhhhh.........eeeee.hhhhhhhhhhhhhhhhh...eeeeehhhhhhhhhh....eee.hhhhh-----..hhhhhhhh....eeee....hhhhhhhhhhhhhhhhhh...ee.hhhhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) --------------------------------L----S-T--S---------M------V-------N----L---------------------------L---A---------Q--------R---------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------------------------------------------------------------------------------W------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                2yvq A    5 SSG-HTAFLKAMLSTGFKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPATPVAWPSQE-----LSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQ 1478
                              | | 1348      1358      1368      1378      1388      1398      1408     |   - |    1428      1438      1448      1458      1468      1478
                              7 |                                                                   1414  1420                                                          
                             1343

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2YVQ)

(no "CATH Domain" information available for 2YVQ)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: MGS] (13)

Family: MGS (13)

Homo sapiens (Human) (2)

MGS-2yvqA01

A:1373-1465

Asymmetric Unit(hide GO term definitions)

Chain A (CPSM_HUMAN | P31327)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0004070	aspartate carbamoyltransferase activity	Catalysis of the reaction: L-aspartate + carbamoyl phosphate = N-carbamoyl-L-aspartate + H(+) + phosphate.
	GO:0005509	calcium ion binding	Interacting selectively and non-covalently with calcium ions (Ca2+).
	GO:0004087	carbamoyl-phosphate synthase (ammonia) activity	Catalysis of the reaction: 2 ATP + CO(2) + H(2)O + NH(4)(+) = 2 ADP + carbamoyl phosphate + 5 H(+) + phosphate.
	GO:0004088	carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity	Catalysis of the reaction: 2 ATP + L-glutamine + CO2 + H2O = 2 ADP + phosphate + glutamate + carbamoyl phosphate.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0004151	dihydroorotase activity	Catalysis of the reaction: (S)-dihydroorotate + H(2)O = N-carbamoyl-L-aspartate + H(+).
	GO:0004175	endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
	GO:0016595	glutamate binding	Interacting selectively and non-covalently with glutamate, the anion of 2-aminopentanedioic acid.
	GO:0016874	ligase activity	Catalysis of the joining of two substances, or two groups within a single molecule, with the concomitant hydrolysis of the diphosphate bond in ATP or a similar triphosphate.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0072341	modified amino acid binding	Interacting selectively and non-covalently with a modified amino acid.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005543	phospholipid binding	Interacting selectively and non-covalently with phospholipids, a class of lipids containing phosphoric acid as a mono- or diester.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006207	'de novo' pyrimidine nucleobase biosynthetic process	The chemical reactions and pathways resulting in the formation of pyrimidine nucleobases, 1,3-diazine, organic nitrogenous bases, beginning with the synthesis of a pyrimidine ring from simpler precursors.
	GO:0055081	anion homeostasis	Any process involved in the maintenance of an internal steady state of anions within an organism or cell.
	GO:0006526	arginine biosynthetic process	The chemical reactions and pathways resulting in the formation of arginine, 2-amino-5-(carbamimidamido)pentanoic acid.
	GO:0070409	carbamoyl phosphate biosynthetic process	The chemical reactions and pathways resulting in the formation of carbamoyl phosphate, an intermediate in the urea cycle and other nitrogen compound metabolic pathways.
	GO:0071320	cellular response to cAMP	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
	GO:0044344	cellular response to fibroblast growth factor stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an fibroblast growth factor stimulus.
	GO:0071377	cellular response to glucagon stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucagon stimulus.
	GO:0071400	cellular response to oleic acid	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an oleic acid stimulus.
	GO:0019240	citrulline biosynthetic process	The chemical reactions and pathways resulting in the formation of citrulline, N5-carbamoyl-L-ornithine, an alpha amino acid not found in proteins.
	GO:0006541	glutamine metabolic process	The chemical reactions and pathways involving glutamine, 2-amino-4-carbamoylbutanoic acid.
	GO:0005980	glycogen catabolic process	The chemical reactions and pathways resulting in the breakdown of glycogen, a polydisperse, highly branched glucan composed of chains of D-glucose residues.
	GO:0070365	hepatocyte differentiation	The process in which a relatively unspecialized cell acquires the specialized features of a hepatocyte. A hepatocyte is specialized epithelial cell that is organized into interconnected plates called lobules, and is the main structural component of the liver.
	GO:0050667	homocysteine metabolic process	The chemical reactions and pathways involving homocysteine, the amino acid alpha-amino-gamma-mercaptobutanoic acid. Homocysteine is an important intermediate in the metabolic reactions of its S-methyl derivative, methionine.
	GO:0001889	liver development	The process whose specific outcome is the progression of the liver over time, from its formation to the mature structure. The liver is an exocrine gland which secretes bile and functions in metabolism of protein and carbohydrate and fat, synthesizes substances involved in the clotting of the blood, synthesizes vitamin A, detoxifies poisonous substances, stores glycogen, and breaks down worn-out erythrocytes.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0007494	midgut development	The process whose specific outcome is the progression of the midgut over time, from its formation to the mature structure. The midgut is the middle part of the alimentary canal from the stomach, or entrance of the bile duct, to, or including, the large intestine.
	GO:0046209	nitric oxide metabolic process	The chemical reactions and pathways involving nitric oxide, nitrogen monoxide (NO), a colorless gas only slightly soluble in water.
	GO:0006807	nitrogen compound metabolic process	The chemical reactions and pathways involving organic or inorganic compounds that contain nitrogen.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0014075	response to amine	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amine stimulus. An amine is a compound formally derived from ammonia by replacing one, two or three hydrogen atoms by hydrocarbyl groups.
	GO:0043200	response to amino acid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups.
	GO:0051591	response to cAMP	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
	GO:0071548	response to dexamethasone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a dexamethasone stimulus.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0032094	response to food	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a food stimulus; food is anything which, when taken into the body, serves to nourish or build up the tissues or to supply body heat.
	GO:0033762	response to glucagon	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucagon stimulus.
	GO:0051384	response to glucocorticoid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucocorticoid stimulus. Glucocorticoids are hormonal C21 corticosteroids synthesized from cholesterol with the ability to bind with the cortisol receptor and trigger similar effects. Glucocorticoids act primarily on carbohydrate and protein metabolism, and have anti-inflammatory effects.
	GO:0060416	response to growth hormone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a growth hormone stimulus. Growth hormone is a peptide hormone that binds to the growth hormone receptor and stimulates growth.
	GO:0032496	response to lipopolysaccharide	Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0034201	response to oleic acid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an oleic acid stimulus.
	GO:0042594	response to starvation	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a starvation stimulus, deprivation of nourishment.
	GO:0048545	response to steroid hormone	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a steroid hormone stimulus.
	GO:0009636	response to toxic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a toxic stimulus.
	GO:0010043	response to zinc ion	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a zinc ion stimulus.
	GO:0019433	triglyceride catabolic process	The chemical reactions and pathways resulting in the breakdown of a triglyceride, any triester of glycerol.
	GO:0000050	urea cycle	The sequence of reactions by which arginine is synthesized from ornithine, then cleaved to yield urea and regenerate ornithine. The overall reaction equation is NH3 + CO2 + aspartate + 3 ATP + 2 H2O = urea + fumarate + 2 ADP + 2 phosphate + AMP + diphosphate.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0042645	mitochondrial nucleoid	The region of a mitochondrion to which the DNA is confined.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2yvq)

	Sites
(no "Sites" information available for 2yvq)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2yvq)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2yvq
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CPSM_HUMAN \| P31327
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	6.3.4.16
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	237300
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CPSM_HUMAN \| P31327
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CPSM_HUMAN \| P31327	:	4utr 4utv 4utx 4utz 4uu7 4uu8 4uua 4uub 5dot 5dou

(no "Related Entries Specified in the PDB File" available for 2YVQ)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (13, 13)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (1, 1)

Gene Ontology (60, 60)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File