2YRA - JenaLib

NMR Structure - manually (Jmol Viewer)

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   SOLUTION STRUCTURE OF THE ZINC FINGER DOMAINS (1-87) FROM HUMAN F-BOX ONLY PROTEIN

Authors :   T. Nagashima, F. Hayashi, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   02 Apr 07 (Deposition) - 02 Oct 07 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Disulfide Bond, Sushi Domain, Scr, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Nagashima, F. Hayashi, S. Yokoyama
Solution Structure Of The Zinc Finger Domains (1-87) From Human F-Box Only Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - SEIZURE 6-LIKE PROTEIN ISOFORM 3
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P050919-01
	Expression System Vector Type	:	PLASMID
	Fragment	:	CCP DOMAIN
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2YRA)

(no "Site" information available for 2YRA)

NMR Structure

No.	Residues
1	A:745	-	A:787
2	A:773	-	A:800

(no "Cis Peptide Bond" information available for 2YRA)

(no "SAP(SNP)/Variant" information available for 2YRA)

NMR Structure (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SUSHI	PS50923	Sushi/CCP/SCR domain profile.	SE6L1_HUMAN	391-450 565-626 743-802 804-867 871-932	3	- - A:745-802 A:803-807 A:808-811

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1c	ENST00000248933	1c	ENSE00001890201	chr22:26565541-26565729	189	SE6L1_HUMAN	1-32	32	0	-	-
1.2b	ENST00000248933	2b	ENSE00001716568	chr22:26688372-26689112	741	SE6L1_HUMAN	32-279	248	0	-	-
1.3	ENST00000248933	3	ENSE00001668531	chr22:26690258-26690391	134	SE6L1_HUMAN	279-323	45	0	-	-
1.4	ENST00000248933	4	ENSE00001778626	chr22:26692854-26693046	193	SE6L1_HUMAN	324-388	65	0	-	-
1.5	ENST00000248933	5	ENSE00001745829	chr22:26694950-26695135	186	SE6L1_HUMAN	388-450	63	0	-	-
1.6	ENST00000248933	6	ENSE00001706165	chr22:26701945-26702110	166	SE6L1_HUMAN	450-505	56	0	-	-
1.7	ENST00000248933	7	ENSE00001661391	chr22:26706636-26706802	167	SE6L1_HUMAN	505-561	57	0	-	-
1.8	ENST00000248933	8	ENSE00001604219	chr22:26707734-26707928	195	SE6L1_HUMAN	561-626	66	0	-	-
1.9	ENST00000248933	9	ENSE00001666301	chr22:26709730-26709868	139	SE6L1_HUMAN	626-672	47	0	-	-
1.10	ENST00000248933	10	ENSE00001701445	chr22:26736402-26736598	197	SE6L1_HUMAN	672-738	67	1	A:738-744 (gaps)	31
1.11a	ENST00000248933	11a	ENSE00001771464	chr22:26743685-26743879	195	SE6L1_HUMAN	738-803	66	1	A:745-802	58
1.12a	ENST00000248933	12a	ENSE00001713959	chr22:26747018-26747209	192	SE6L1_HUMAN	803-867	65	1	A:803-807 (gaps)	48
1.14	ENST00000248933	14	ENSE00001150798	chr22:26761338-26761532	195	SE6L1_HUMAN	867-932	66	1	A:808-811	4
1.15	ENST00000248933	15	ENSE00001150782	chr22:26769417-26769449	33	SE6L1_HUMAN	932-943	12	0	-	-
1.16a	ENST00000248933	16a	ENSE00001150792	chr22:26771541-26771655	115	SE6L1_HUMAN	943-981	39	0	-	-
1.17b	ENST00000248933	17b	ENSE00001649513	chr22:26773639-26773741	103	SE6L1_HUMAN	981-1015	35	0	-	-
1.18b	ENST00000248933	18b	ENSE00001892582	chr22:26776232-26776339	108	SE6L1_HUMAN	1016-1024	9	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:74
 aligned with SE6L1_HUMAN | Q9BYH1 from UniProtKB/Swiss-Prot  Length:1024

    Alignment length:184
                                   708       718       728       738       748       758       768       778       788       798       808       818       828       838       848       858       868       878    
          SE6L1_HUMAN   699 GNSGPQKLYSSTPDLTIQFHSDPAGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARITYQCDPGYDIVGSDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVLLVGTTIQYTCNPGFVLEGSSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENG 882
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------Sushi-2yraA01 A:745-800                                 ---------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....-----..-------------------.---------------.........eee...........eeeeee...eeee...eee............eeee----..-------------------------------------------...------------------------.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------SUSHI  PDB: A:745-802 UniProt: 743-802                      -SUSHI  PDB: A:803-807 UniProt: 804-867                          ---SUSHI        PROSITE
           Transcript 1 (1) Exon 1.10  PDB: A:738-744 (gaps)        ----------------------------------------------------------------Exon 1.12a  PDB: A:803-807 (gaps) UniProt: 803-867 [INCOMPLETE]  --------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------Exon 1.11a  PDB: A:745-802 UniProt: 738-803 [INCOMPLETE]          ---------------------------------------------------------------Exon 1.14        Transcript 1 (2)
                 2yra A 738 GSSG-----SS-------------------G---------------CSDLPEIQNGWKTTSHTELVRGARITYQCDPGYDIVGSDTLTCQWDLSWSSDPPFCEK----TE-------------------------------------------ESG------------------------PSSG 811
                               |   742|        -         -|        -      |748       758       768       778       788       798   |   804         -         -         -         -   | |   -         -         -|   
                             741   742|                 744             745                                                      802  803|                                         805 |                      808   
                                    743                                                                                                804                                           807

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2YRA)

(no "CATH Domain" information available for 2YRA)

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Sushi] (50)

Family: Sushi (50)

Homo sapiens (Human) (42)

Sushi-2yraA01

A:745-800

NMR Structure(hide GO term definitions)

Chain A (SE6L1_HUMAN | Q9BYH1)

biological process
	GO:0008344	adult locomotory behavior	Locomotory behavior in a fully developed and mature organism.
	GO:0021680	cerebellar Purkinje cell layer development	The process whose specific outcome is the progression of the cerebellar Purkinje cell layer over time, from its formation to the mature structure. The Purkinje cell layer lies just underneath the molecular layer of the cerebellar cortex. It contains the neuronal cell bodies of the Purkinje cells that are arranged side by side in a single layer. Candelabrum interneurons are vertically oriented between the Purkinje cells. Purkinje neurons are inhibitory and provide the output of the cerebellar cortex through axons that project into the white matter. Extensive dendritic trees from the Purkinje cells extend upward in a single plane into the molecular layer where they synapse with parallel fibers of granule cells.
	GO:0090036	regulation of protein kinase C signaling	Any process that modulates the frequency, rate, or extent of a series of reactions, mediated by the intracellular serine/threonine kinase protein kinase C, which occurs as a result of a single trigger reaction or compound.
	GO:0060074	synapse maturation	The process that organizes a synapse so that it attains its fully functional state. Synaptic maturation plays a critical role in the establishment of effective synaptic connections in early development.
cellular component
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0043025	neuronal cell body	The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2yra)

	Sites
(no "Sites" information available for 2yra)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2yra)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2yra
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SE6L1_HUMAN \| Q9BYH1
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SE6L1_HUMAN \| Q9BYH1
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2YRA)

(no "Related Entries Specified in the PDB File" available for 2YRA)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (2, 2)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 3)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (1, 1)

Gene Ontology (9, 9)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File