|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 5)| Asymmetric Unit (3, 5) Biological Unit 1 (2, 8) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2Y78) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2Y78) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2Y78) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2Y78) |
Exons (0, 0)| (no "Exon" information available for 2Y78) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:122 aligned with Q63J95_BURPS | Q63J95 from UniProtKB/TrEMBL Length:113 Alignment length:122 1 1 11 21 31 41 51 61 71 81 91 101 111 Q63J95_BURPS - ---------MTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV 113 SCOP domains d2y78a_ A: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------FKBP_C-2y78A01 A:20-111 -- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript 2y78 A -8 SGLVPRGSHMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV 113 1 11 21 31 41 51 61 71 81 91 101 111
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2Y78) |
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (Q63J95_BURPS | Q63J95)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|