Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  N-TERMINAL HEAD DOMAIN OF DANIO RERIO SAS-6
 
Authors :  M. Van Breugel
Date :  27 Dec 10  (Deposition) - 09 Feb 11  (Release) - 16 Mar 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.92
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Structural Protein, Cytoskeleton, Basal Body, Centriole, Cartwheel, Cartwheel Hub (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Van Breugel, M. Hirono, A. Andreeva, H. A. Yanagisawa, S. Yamaguchi, Y. Nakazawa, N. Morgner, M. Petrovich, I. O. Ebong, C. V. Robinson, C. M. Johnson, D. Veprintsev, B. Zuber
Structures Of Sas-6 Suggest Its Organization In Centrioles.
Science V. 331 1196 2011
PubMed-ID: 21273447  |  Reference-DOI: 10.1126/SCIENCE.1199325

(-) Compounds

Molecule 1 - SPINDLE ASSEMBLY ABNORMAL PROTEIN 6 HOMOLOG
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28 DERIVATIVE
    Expression System Strain: ROSETTA
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: HEAD DOMAIN, RESIDUES 1-156
    Organism Common: ZEBRAFISH
    Organism Scientific: DANIO RERIO
    Organism Taxid: 7955
    Other Details: CDNA FROM ZEBRAFISH
    Synonym: SAS6

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A   
Biological Unit 2 (1x):  B  
Biological Unit 3 (1x):   C 
Biological Unit 4 (1x):    D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2Y3V)

(-) Sites  (0, 0)

(no "Site" information available for 2Y3V)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2Y3V)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2Y3V)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2Y3V)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2Y3V)

(-) Exons   (0, 0)

(no "Exon" information available for 2Y3V)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:158
 aligned with SAS6_DANRE | Q7ZVT3 from UniProtKB/Swiss-Prot  Length:627

    Alignment length:158
                              1                                                                                                                                                           
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148        
           SAS6_DANRE     - --MTELLFNKRLQVLVKSKDTDERRSVIRVSIELQLPSSPVHRKDLVVRLTDDTDLYFLYNLIISEEDFQSLKVQQGLLIDFTSFPQKFIDLLEQCICEQDKESPRFLLQLSSSSSAFDHSPSNLNIVETNAFKHLTHLSLKLLPGSDTDIKKYLASC 156
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeeeeeee......eeeeeeeeeeee.........eeeeeeee..eeeeeeeeeehhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh......eeeeee..........eeeeeee......eeeeeeeeee.hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2y3v A  -1 PHMTELLFNKRLQVLVKSKDTDERRSVIRVSIELQLPSSPVHRKDLVVRLTDDTDLYFLYNLIISEEDFQSLKVQQGLLIDFTSFPQKFIDLLEQCICEQDKENPRFLLQLSSSSSAFDHSPSNLNIVETNAFKHLTHLSLKLLPGSDTDIKKYLASC 156
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148        

Chain B from PDB  Type:PROTEIN  Length:159
 aligned with SAS6_DANRE | Q7ZVT3 from UniProtKB/Swiss-Prot  Length:627

    Alignment length:159
                               1                                                                                                                                                           
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147         
           SAS6_DANRE     - ---MTELLFNKRLQVLVKSKDTDERRSVIRVSIELQLPSSPVHRKDLVVRLTDDTDLYFLYNLIISEEDFQSLKVQQGLLIDFTSFPQKFIDLLEQCICEQDKESPRFLLQLSSSSSAFDHSPSNLNIVETNAFKHLTHLSLKLLPGSDTDIKKYLASC 156
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeeeeeeeee......eeeeeeeeeeee.........eeeeeeee..eeeeeeeeeehhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh......eeeeee..........eeeeeee......eeeeeeeeee.hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2y3v B  -2 GPHMTELLFNKRLQVLVKSKDTDERRSVIRVSIELQLPSSPVHRKDLVVRLTDDTDLYFLYNLIISEEDFQSLKVQQGLLIDFTSFPQKFIDLLEQCICEQDKENPRFLLQLSSSSSAFDHSPSNLNIVETNAFKHLTHLSLKLLPGSDTDIKKYLASC 156
                                     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147         

Chain C from PDB  Type:PROTEIN  Length:146
 aligned with SAS6_DANRE | Q7ZVT3 from UniProtKB/Swiss-Prot  Length:627

    Alignment length:146
                              1                                                                                                                                               
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138      
           SAS6_DANRE     - --MTELLFNKRLQVLVKSKDTDERRSVIRVSIELQLPSSPVHRKDLVVRLTDDTDLYFLYNLIISEEDFQSLKVQQGLLIDFTSFPQKFIDLLEQCICEQDKESPRFLLQLSSSSSAFDHSPSNLNIVETNAFKHLTHLSLKLLPG 144
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeeeeeeee......eeeeeeeeeeeeee.......eeeeeeee..eeeeeeeeeehhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh......eeeeee..........eeeeeee......eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2y3v C  -1 PHMTELLFNKRLQVLVKSKDTDERRSVIRVSIELQLPSSPVHRKDLVVRLTDDTDLYFLYNLIISEEDFQSLKVQQGLLIDFTSFPQKFIDLLEQCICEQDKENPRFLLQLSSSSSAFDHSPSNLNIVETNAFKHLTHLSLKLLPG 144
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138      

Chain D from PDB  Type:PROTEIN  Length:154
 aligned with SAS6_DANRE | Q7ZVT3 from UniProtKB/Swiss-Prot  Length:627

    Alignment length:154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    
           SAS6_DANRE     1 MTELLFNKRLQVLVKSKDTDERRSVIRVSIELQLPSSPVHRKDLVVRLTDDTDLYFLYNLIISEEDFQSLKVQQGLLIDFTSFPQKFIDLLEQCICEQDKESPRFLLQLSSSSSAFDHSPSNLNIVETNAFKHLTHLSLKLLPGSDTDIKKYLA 154
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeeee......eeeeeeeeeeee.........eeeeeeee..eeeeeeeeeehhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh......eeeeeee.........eeeeeee......eeeeeeeeee.hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2y3v D   1 MTELLFNKRLQVLVKSKDTDERRSVIRVSIELQLPSSPVHRKDLVVRLTDDTDLYFLYNLIISEEDFQSLKVQQGLLIDFTSFPQKFIDLLEQCICEQDKENPRFLLQLSSSSSAFDHSPSNLNIVETNAFKHLTHLSLKLLPGSDTDIKKYLA 154
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2Y3V)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2Y3V)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2Y3V)

(-) Gene Ontology  (13, 13)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (SAS6_DANRE | Q7ZVT3)
biological process
    GO:0007049    cell cycle    The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
    GO:0007099    centriole replication    The cell cycle process in which a daughter centriole is formed perpendicular to an existing centriole. An immature centriole contains a ninefold radially symmetric array of single microtubules; mature centrioles consist of a radial array of nine microtubule triplets, doublets, or singlets depending upon the species and cell type. Duplicated centrioles also become the ciliary basal body in cells that form cilia during G0.
    GO:0051298    centrosome duplication    The replication of a centrosome, a structure comprised of a pair of centrioles and peri-centriolar material from which a microtubule spindle apparatus is organized.
    GO:0040016    embryonic cleavage    The first few specialized divisions of an activated animal egg.
    GO:0007052    mitotic spindle organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the microtubule spindle during a mitotic cell cycle.
    GO:0000280    nuclear division    The division of a cell nucleus into two nuclei, with DNA and other nuclear contents distributed between the daughter nuclei.
    GO:0007283    spermatogenesis    The process of formation of spermatozoa, including spermatocytogenesis and spermiogenesis.
cellular component
    GO:0005814    centriole    A cellular organelle, found close to the nucleus in many eukaryotic cells, consisting of a small cylinder with microtubular walls, 300-500 nm long and 150-250 nm in diameter. It contains nine short, parallel, peripheral microtubular fibrils, each fibril consisting of one complete microtubule fused to two incomplete microtubules. Cells usually have two centrioles, lying at right angles to each other. At division, each pair of centrioles generates another pair and the twin pairs form the pole of the mitotic spindle.
    GO:0005813    centrosome    A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0098536    deuterosome    A spherical, electron dense, cytoplasmic structure that is involved in de novo assembly of centrioles.
    GO:0005815    microtubule organizing center    An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2y3v)
 
  Sites
(no "Sites" information available for 2y3v)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2y3v)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2y3v
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SAS6_DANRE | Q7ZVT3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SAS6_DANRE | Q7ZVT3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SAS6_DANRE | Q7ZVT3: 2y3w

(-) Related Entries Specified in the PDB File

2y3w N-TERMINAL HEAD DOMAIN AND BEGINNING OF COILED COIL DOMAIN OF DANIO RERIO SAS-6