Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  VIBRIO CHOLERAE COLONIZATION FACTOR GBPA CRYSTAL STRUCTURE
 
Authors :  E. Wong, G. Vaaje-Kolstad, A. Ghosh, R. H. Guerrero, P. V. Konarev, A. F. M. Ibrahim, D. I. Svergun, V. G. H. Eijsink, N. S. Chatterjee, D. M. F. Van Aalten
Date :  06 Nov 10  (Deposition) - 16 Nov 11  (Release) - 15 Apr 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Chitin-Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  E. Wong, G. Vaaje-Kolstad, A. Ghosh, R. Hurtado-Guerrero, P. V. Konarev, A. F. M. Ibrahim, D. I. Svergun, V. G. H. Eijsink, N. S. Chatterjee, D. M. F. Van Aalten
The Vibrio Cholerae Colonization Factor Gbpa Possesses A Modular Structure That Governs Binding To Different Host Surfaces.
Plos Pathog. V. 8 2373 2012
PubMed-ID: 22253590  |  Reference-DOI: 10.1371/JOURNAL.PPAT.1002373

(-) Compounds

Molecule 1 - GLCNAC-BINDING PROTEIN A
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PGEX6P GBPA
    Expression System Strain: C43
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: RESIDUES 24-414
    Organism Scientific: VIBRIO CHOLERAE
    Organism Taxid: 666
    Other Details: CLONED FROM GENOMIC DNA OF V. CHOLERAE
    Synonym: GBPA

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2XWX)

(-) Sites  (0, 0)

(no "Site" information available for 2XWX)

(-) SS Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1A:42 -A:56
2A:152 -A:169
3B:42 -B:56
4B:152 -B:169

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Phe A:72 -Pro A:73
2Phe B:72 -Pro B:73
3Gln B:315 -Pro B:316
4Ile B:331 -Gly B:332

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2XWX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2XWX)

(-) Exons   (0, 0)

(no "Exon" information available for 2XWX)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:385
 aligned with GBPA_VIBCH | Q9KLD5 from UniProtKB/Swiss-Prot  Length:485

    Alignment length:391
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413 
           GBPA_VIBCH    24 HGYVSAVENGVAEGRVTLCKFAANGTGEKNTHCGAIQYEPQSVEGPDGFPVTGPRDGKIASAESALAAALDEQTADRWVKRPIQAGPQTFEWTFTANHVTKDWKYYITKPNWNPNQPLSRDAFDLNPFCVVEGNMVQPPKRVSHECIVPEREGYQVILAVWDVGDTAASFYNVIDVKFDGNGPVLPDWNPAGQIIPSMDLSIGDTVYTRVFDNDGENPAYRTELKIDSETLTKANQWSYALATKINQTQKQQRAGQLNGDQFVPVYGTNPIYLKEGSGLKSVEIGYQIEAPQPEYSLTVSGLAKEYEIGEQPIQLDLTLEAQGEMSAELTVYNHHQKPLASWSQAMTDGELKSITLELSEAKAGHHMLVSRIKDRDGNLQDQQTLDFMLVE 414
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..........hhhhhh...........hhhhhhhhhh.eee.................hhhhhhhhh........eee..eeeeeeeee.....eeeeeeee...........hhhh......eeeeeeee....eeeeeeee....eeeeeeeeeee....eeeeeeeeeee.------..eeeeeee..........eeeeeeee..ee.hhhh.eee..hhhhhhhhhhhhhhhhhhhhhh..eee.eee..eee.....eeeeee......eeeeeee........eeeee....eee......eeeeeeeee..eeeeeeee.....eeeeeeeee....eeeeeee......eeeeeeeeeee....eeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2xwx A  24 HGYVSAVENGVAEGRVTLCKFAANGTGEKNTHCGAIQYEPQSVEGPDGFPVTGPRDGKIASAESALAAALDEQTADRWVKRPIQAGPQTFEWTFTANHVTKDWKYYITKPNWNPNQPLSRDAFDLNPFCVVEGNMVQPPKRVSHECIVPEREGYQVILAVWDVGDTAASFYNVIDVKFD------PDWNPAGQIIPSMDLSIGDTVYTRVFDNDGENPAYRTELKIDSETLTKANQWSYALATKINQTQKQQRAGQLNGDQFVPVYGTNPIYLKEGSGLKSVEIGYQIEAPQPEYSLTVSGLAKEYEIGEQPIQLDLTLEAQGEMSAELTVYNHHQKPLASWSQAMTDGELKSITLELSEAKAGHHMLVSRIKDRDGNLQDQQTLDFMLVE 414
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193        |-     | 213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413 
                                                                                                                                                                                                            202    209                                                                                                                                                                                                             


Chain B from PDB  Type:PROTEIN  Length:385
 aligned with GBPA_VIBCH | Q9KLD5 from UniProtKB/Swiss-Prot  Length:485

    Alignment length:391
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413 
           GBPA_VIBCH    24 HGYVSAVENGVAEGRVTLCKFAANGTGEKNTHCGAIQYEPQSVEGPDGFPVTGPRDGKIASAESALAAALDEQTADRWVKRPIQAGPQTFEWTFTANHVTKDWKYYITKPNWNPNQPLSRDAFDLNPFCVVEGNMVQPPKRVSHECIVPEREGYQVILAVWDVGDTAASFYNVIDVKFDGNGPVLPDWNPAGQIIPSMDLSIGDTVYTRVFDNDGENPAYRTELKIDSETLTKANQWSYALATKINQTQKQQRAGQLNGDQFVPVYGTNPIYLKEGSGLKSVEIGYQIEAPQPEYSLTVSGLAKEYEIGEQPIQLDLTLEAQGEMSAELTVYNHHQKPLASWSQAMTDGELKSITLELSEAKAGHHMLVSRIKDRDGNLQDQQTLDFMLVE 414
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..........hhhhhh...........hhhhhhhhhh.eee.................hhhhhhhhh........eee..eeeeeeeee.....eeeeeeee...........hhhh......eeeeeeee....eeeeeeee....eeeeeeeeeee....eeeeeeeeeee.------..eeeeeee..........eeeeeeee..ee.hhhh.eee...hhhhhhhhhhhhhhhhhhhhh..eee.eee..eee.....eeeeee....eeeeeeeee........eeeee....eee......eeeeeeeee..eeeeeeee.....eeeeeeeee....eeeeeee......eeeeeeeeeee....eeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2xwx B  24 HGYVSAVENGVAEGRVTLCKFAANGTGEKNTHCGAIQYEPQSVEGPDGFPVTGPRDGKIASAESALAAALDEQTADRWVKRPIQAGPQTFEWTFTANHVTKDWKYYITKPNWNPNQPLSRDAFDLNPFCVVEGNMVQPPKRVSHECIVPEREGYQVILAVWDVGDTAASFYNVIDVKFD------PDWNPAGQIIPSMDLSIGDTVYTRVFDNDGENPAYRTELKIDSETLTKANQWSYALATKINQTQKQQRAGQLNGDQFVPVYGTNPIYLKEGSGLKSVEIGYQIEAPQPEYSLTVSGLAKEYEIGEQPIQLDLTLEAQGEMSAELTVYNHHQKPLASWSQAMTDGELKSITLELSEAKAGHHMLVSRIKDRDGNLQDQQTLDFMLVE 414
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193        |-     | 213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413 
                                                                                                                                                                                                            202    209
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2XWX)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2XWX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2XWX)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (GBPA_VIBCH | Q9KLD5)
molecular function
    GO:0008061    chitin binding    Interacting selectively and non-covalently with chitin, a linear polysaccharide consisting of beta-(1->4)-linked N-acetyl-D-glucosamine residues.
    GO:0004568    chitinase activity    Catalysis of the hydrolysis of (1->4)-beta linkages of N-acetyl-D-glucosamine (GlcNAc) polymers of chitin and chitodextrins.
biological process
    GO:0006032    chitin catabolic process    The chemical reactions and pathways resulting in the breakdown of chitin, a linear polysaccharide consisting of beta-(1->4)-linked N-acetyl-D-glucosamine residues.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2xwx)
 
  Sites
(no "Sites" information available for 2xwx)
 
  Cis Peptide Bonds
    Gln B:315 - Pro B:316   [ RasMol ]  
    Ile B:331 - Gly B:332   [ RasMol ]  
    Phe A:72 - Pro A:73   [ RasMol ]  
    Phe B:72 - Pro B:73   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2xwx
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GBPA_VIBCH | Q9KLD5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GBPA_VIBCH | Q9KLD5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2XWX)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2XWX)