|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (2, 2)
Asymmetric Unit
|
||||||||||||
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2XT1) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2XT1) |
Exons (0, 0)| (no "Exon" information available for 2XT1) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:86 aligned with Q71B32_9HIV1 | Q71B32 from UniProtKB/TrEMBL Length:231 Alignment length:86 155 165 175 185 195 205 215 225 Q71B32_9HIV1 146 SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVL 231 SCOP domains d2xt1a_ A: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------- Transcript 2xt1 A 146 SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL 231 155 165 175 185 195 205 215 225
Chain B from PDB Type:PROTEIN Length:114
SCOP domains d2xt1b_ B: automated matches SCOP domains
CATH domains ------------------------------------------------------------------------------------------------------------------ CATH domains
Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
PROSITE ------------------------------------------------------------------------------------------------------------------ PROSITE
Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
2xt1 B 0 AQVQLVESGGGLVQAGGSLRLSCAASGSFFMSNVMAWYRQAPGKARELIAAIRGGDMSTVYDDSVKGRFTITRDDDKNILYLQMNDLKPEDTAMYYCKASGSSWGQGTQVTVSS 113
9 19 29 39 49 | 58 68 78 ||| 85 95|| 109
52A 82A|| 96|
82B| 101
82C
|
||||||||||||||||||||
SCOP Domains (2, 2)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2XT1) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2XT1) |
Gene Ontology (3, 3)|
Asymmetric Unit(hide GO term definitions) Chain A (Q71B32_9HIV1 | Q71B32)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|