|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2XST) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2XST) |
SAPs(SNPs)/Variants (2, 2)
Asymmetric/Biological Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2XST) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:149 aligned with LCN15_HUMAN | Q6UWW0 from UniProtKB/Swiss-Prot Length:184 Alignment length:154 29 39 49 59 69 79 89 99 109 119 129 139 149 159 169 LCN15_HUMAN 20 AEVLLQPDFNAEKFSGLWYVVSMASDCRVFLGKKDHLSMSTRAIRPTEEGGLHVHMEFPGADGCNQVDAEYLKVGSEGHFRVPALGYLDVRIVDTDYSSFAVLYIYKELEGALSTMVQLYSRTQDVSPQALKSFQDFYPTLGLPKDMMVMLPQS 173 SCOP domains d2xsta_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------Lipocalin-2xstA01 A:34-173 Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------A-----------E--------- SAPs(SNPs) PROSITE -------LIPOCALIN ------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2xst A 20 AEVLLQPDFNAEKFSGLWYVVSMASDCRVFLGKKDHLSMSTRAIRPTEEGGLHVHMEFP-----NQVDAEYLKVGSEGHFRVPALGYLDVRIVDTDYSSFAVLYIYKELEGALSTMVQLYSRTQDVSPQALKSFQDFYPTLGLPKDMMVMLPQS 173 29 39 49 59 69 |- | 89 99 109 119 129 139 149 159 169 78 84
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2XST) |
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (5, 5)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (LCN15_HUMAN | Q6UWW0)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|