Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF DESULFORUBIDIN FROM DESULFOMICROBIUM NORVEGICUM
 
Authors :  T. F. Oliveira, A. R. Khan, I. A. C. Pereira, M. Archer
Date :  29 Sep 10  (Deposition) - 24 Aug 11  (Release) - 14 Sep 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.53
Chains :  Asym./Biol. Unit :  A,B,C,D,E,F
Keywords :  Dissimilatory Sulfite Reductase, Sulfur Metabolism, Dsrabc, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. F. Oliveira, E. Franklin, J. P. Afonso, A. R. Khan, N. J. Oldham, I. A. C. Pereira, M. Archer
Structural Insights Into Dissimilatory Sulfite Reductases: Structure Of Desulforubidin From Desulfomicrobium Norvegicum
Front. Microbiol. V 2 71 2011
PubMed-ID: 21833321  |  Reference-DOI: 10.3389/FMICB.2011.00071

(-) Compounds

Molecule 1 - SULFITE REDUCTASE ALPHA SUBUNIT
    Chains: A, D
    EC Number: 1.8.99.3
    Organism Scientific: DESULFOMICROBIUM NORVEGICUM
 
Molecule 2 - SULFITE REDUCTASE BETA SUBUNIT
    Chains: B, E
    EC Number: 1.8.99.3
    Organism Scientific: DESULFOMICROBIUM NORVEGICUM
    Other Details: COVALENT BOND BETWEEN THE SG OF CYS 104C/E AND THE 20- MESO CARBON OF THE CATALYTIC SIROHEME PORPHYRIN RING
 
Molecule 3 - SULFUR RELAY PROTEIN, TUSE/DSRC/DSVC FAMILY
    Chains: C, F
    EC Number: 1.8.99.3
    Organism Scientific: DESULFOMICROBIUM NORVEGICUM

 Structural Features

(-) Chains, Units

  123456
Asymmetric/Biological Unit : ABCDEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 14)

Asymmetric/Biological Unit (3, 14)
No.NameCountTypeFull Name
1SF48Ligand/IonIRON/SULFUR CLUSTER
2SO32Ligand/IonSULFITE ION
3SRM4Ligand/IonSIROHEME

(-) Sites  (14, 14)

Asymmetric Unit (14, 14)
No.NameEvidenceResiduesDescription
01AC1SOFTWARECYS A:284 , CYS A:288 , CYS A:303 , THR A:304 , CYS A:306 , MET A:307 , CYS A:309BINDING SITE FOR RESIDUE SF4 A 501
02AC2SOFTWARECYS A:177 , CYS A:183 , TRP A:185 , ALA A:186 , GLY A:220 , CYS A:221 , ASN A:223 , CYS A:225BINDING SITE FOR RESIDUE SF4 A 502
03AC3SOFTWARECYS A:177 , LEU A:178 , ARG A:182 , CYS A:183 , GLU A:184 , TRP A:185 , ASN A:223 , GLY A:224 , CYS A:225 , ASN A:262 , ASN A:311 , HOH A:2122 , HOH A:2124 , HOH A:2150 , HOH A:2151 , HOH A:2180 , HOH A:2307 , HOH A:2308 , HOH A:2309 , HOH A:2310 , HOH A:2311 , HOH A:2313 , HOH A:2314 , HOH A:2315 , HOH A:2316 , HIS B:44 , ILE B:46 , HIS B:54 , ARG B:66 , ARG B:94 , THR B:96 , THR B:97 , ARG B:98 , ASN B:100 , THR B:135 , GLY B:136 , THR B:140 , ARG B:183 , LYS B:293 , VAL B:294 , SER B:295 , ARG B:297 , ARG B:341BINDING SITE FOR RESIDUE SRM A 503
04AC4SOFTWARECYS B:231 , ILE B:236 , CYS B:263 , MET B:264 , CYS B:266 , GLY B:267 , CYS B:269BINDING SITE FOR RESIDUE SF4 B 501
05AC5SOFTWARETHR B:145 , GLN B:146 , CYS B:151 , THR B:153 , PRO B:154 , CYS B:188 , CYS B:189 , ASN B:191 , CYS B:193 , SRM B:503BINDING SITE FOR RESIDUE SF4 B 502
06AC6SOFTWAREARG A:83 , ARG A:101 , GLY A:134 , ALA A:135 , THR A:136 , GLY A:137 , ASP A:138 , TYR A:212 , LYS A:213 , LYS A:215 , LYS A:217 , ARG A:231 , LYS A:332 , ALA A:333 , ILE A:335 , ARG A:376 , ARG A:378 , HOH A:2070 , HOH A:2080 , HOH A:2081 , HOH A:2097 , ARG B:71 , HIS B:144 , THR B:145 , GLN B:146 , HIS B:150 , CYS B:151 , HIS B:152 , ASN B:191 , MET B:192 , CYS B:193 , GLY B:194 , SF4 B:502 , SO3 B:504 , GLY C:103 , CYS C:104BINDING SITE FOR RESIDUE SRM B 503
07AC7SOFTWAREARG A:101 , ARG A:172 , LYS A:213 , LYS A:215 , SRM B:503 , CYS C:104BINDING SITE FOR RESIDUE SO3 B 504
08AC8SOFTWARECYS D:284 , CYS D:288 , CYS D:303 , THR D:304 , CYS D:306 , MET D:307 , CYS D:309BINDING SITE FOR RESIDUE SF4 D 501
09AC9SOFTWARECYS D:177 , CYS D:183 , TRP D:185 , ALA D:186 , CYS D:221 , CYS D:225BINDING SITE FOR RESIDUE SF4 D 502
10BC1SOFTWARECYS D:177 , LEU D:178 , ARG D:182 , CYS D:183 , GLU D:184 , TRP D:185 , ASN D:223 , GLY D:224 , CYS D:225 , ASN D:262 , ASN D:311 , HOH D:2120 , HOH D:2123 , HOH D:2156 , HOH D:2157 , HOH D:2274 , HOH D:2275 , HOH D:2276 , HOH D:2277 , HOH D:2278 , HOH D:2279 , HOH D:2280 , HOH D:2281 , HIS E:44 , LEU E:52 , HIS E:54 , ARG E:66 , ARG E:94 , THR E:96 , THR E:97 , ARG E:98 , ASN E:100 , GLY E:134 , THR E:135 , GLY E:136 , THR E:140 , ARG E:183 , LYS E:293 , VAL E:294 , SER E:295 , ARG E:297 , ARG E:341BINDING SITE FOR RESIDUE SRM D 503
11BC2SOFTWARECYS E:231 , ILE E:236 , CYS E:263 , MET E:264 , CYS E:266 , GLY E:267 , CYS E:269BINDING SITE FOR RESIDUE SF4 E 501
12BC3SOFTWARETHR E:145 , GLN E:146 , CYS E:151 , THR E:153 , PRO E:154 , CYS E:188 , CYS E:189 , ASN E:191 , CYS E:193 , SRM E:503BINDING SITE FOR RESIDUE SF4 E 502
13BC4SOFTWAREARG D:83 , ARG D:101 , GLY D:134 , ALA D:135 , THR D:136 , GLY D:137 , ASP D:138 , TYR D:212 , LYS D:213 , LYS D:215 , LYS D:217 , ARG D:231 , LYS D:332 , ALA D:333 , ILE D:335 , ARG D:376 , ARG D:378 , HOH D:2066 , HOH D:2077 , HOH D:2078 , HOH D:2093 , ARG E:71 , HIS E:144 , THR E:145 , GLN E:146 , HIS E:150 , CYS E:151 , HIS E:152 , ASN E:191 , MET E:192 , CYS E:193 , SF4 E:502 , SO3 E:504 , GLY F:103 , CYS F:104BINDING SITE FOR RESIDUE SRM E 503
14BC5SOFTWAREARG D:101 , ARG D:172 , LYS D:213 , LYS D:215 , SRM E:503 , CYS F:104BINDING SITE FOR RESIDUE SO3 E 504

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1B:222 -B:273
2E:222 -E:273

(-) Cis Peptide Bonds  (8, 8)

Asymmetric/Biological Unit
No.Residues
1Met A:132 -His A:133
2Ile A:335 -Leu A:336
3Asp A:353 -Pro A:354
4Pro B:315 -Pro B:316
5Met D:132 -His D:133
6Ile D:335 -Leu D:336
7Asp D:353 -Pro D:354
8Pro E:315 -Pro E:316

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2XSJ)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2XSJ)

(-) Exons   (0, 0)

(no "Exon" information available for 2XSJ)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:436
 aligned with Q93UT1_DESNO | Q93UT1 from UniProtKB/TrEMBL  Length:375

    Alignment length:436
                                                                                         1                                                                                                                                                                                                                                                                                                                                                                                      
                                     -         -         -         -         -         - |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369      
         Q93UT1_DESNO     - -------------------------------------------------------------THWKHGGIVGVFGYGGGVIGRYCDQPQMFPGVAHFHTVRVAQPAGMYYTTDFLKQLCDLWDMRGSGLTNMHGATGDIVLLGTTTPQLEEFYFELTHKMNNDLGGSGSNLRTPASCLGDSRCEWACYDAQELCYQMTQEYQDELHRPAFPYKFKFKFDGCPNGCVASIARSDMSFIGTWRDDIRIDQEAVAAYVGGEIQPNGGAHSGKDWGAFDIQKEVIDLCPTECMWMEDGKLQINNRECTRCMHCLNVMPRALRIGNDRGLSILVGAKAPILDGAQMGSLLVPFIKVEDPYDEIKEIIEGIWEWWMEEGKNRERLGELIKRQGLAKAIAAVGLTPVPQHVMEPRHNPYIFWKEKDVEGGWDRDIADYRKHHQR 375
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhh....hhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhh..................ee.........hhhhh...eeee......eeehhhhhhhhhhhhhhh..eee.......eeee....hhhhhhhhhhhhhhh.............ee.hhhhh......hhhhhhhhhhhhhhhhhhh........eeee.......hhhhhh.eeeeeee....eehhhhhhhhhh...hhhhhh.........hhhhhh........eeee..eeee.hhhh...hhhhhhh...ee....eeeeeee.............eeeeeee.....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh....hhhh............hhhhh......hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2xsj A   2 AKHATPLLDQLQSGPWPSFVADIKEEAERRHSNQDNVEYQIPVDVCDDLLGILELKYSDGTTHWKHGGIVGVFGYGGGVIGRYCDQPQMFPGVAHFHTVRVAQPAGMYYTTDFLKQLCDLWDMRGSGLTNMHGATGDIVLLGTTTPQLEEFYFELTHKMNNDLGGSGSNLRTPASCLGDSRCEWACYDAQELCYQMTQEYQDELHRPAFPYKFKFKFDGCPNGCVASIARSDMSFIGTWRDDIRIDQEAVAAYVGGEIQPNGGAHSGKDWGAFDIQKEVIDLCPTECMWMEDGKLQINNRECTRCMHCLNVMPRALRIGNDRGLSILVGAKAPILDGAQMGSLLVPFIKVEDPYDEIKEIIEGIWEWWMEEGKNRERLGELIKRQGLAKAIAAVGLTPVPQHVMEPRHNPYIFWKEKDVEGGWDRDIADYRKHHQR 437
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431      


Chain B from PDB  Type:PROTEIN  Length:385
 aligned with Q93UT0_DESNO | Q93UT0 from UniProtKB/TrEMBL  Length:271

    Alignment length:385
                                                                                                                                                                                                                                                                                                       271                                                                                                                   
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271         -         -         -         -         -         -         -         -         -         -         -     
         Q93UT0_DESNO     2 AFVSSGYNPEKPMENRISDIGPRHASDFFPPVIAKNKGQWLWHEICEPGILMHKAESGDEVYTVRCGGARLMSVGHIREICAIADKFCGGHLRFTTRNNIEFMVTTLDEAKKLKEYLNAQKFEGGSFKFPVGGTGAGITNIVHTQGWVHCHTPATDASGTVKVVLDELFEEFGQMRMPAQVRISMACCLNMCGAVHCSDIAILGYHRKPPVIDHEWLDNLCEIPLAVAACPVGAIRPTKKEIVTEKGETKTVNTVAIKNERCMFCGNCYT-------------------------------------------------------------------------------------------------------------------   -
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhh.hhhhhhhh..eeeeeeee..eeeeee....eeeeeee....eeehhhhhhhhhhhhhhh..eeee.....eeeee.hhhhhhhhhhhhh..........................hhhhhh.....hhhhhhhhhhhhhhhhh..........eeee.......hhhhh.eeeeee..........hhhhhhhhhhhhhh.....eeeeeeeee.....eeeeeeeee.hhhh...hhhhhhh...........eeeeee..............eeeeeeee.....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh....hhhhh...hhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2xsj B   2 AFVSSGYNPEKPMENRISDIGPRHASDFFPPVIAKNKGQWLWHEICEPGILMHKAESGDEVYTVRCGGARLMSVGHIREICAIADKFCGGHLRFTTRNNIEFMVTTLDEAKKLKEYLNAQKFEGGSFKFPVGGTGAGITNIVHTQGWVHCHTPATDASGTVKVVLDELFEEFGQMRMPAQVRISMACCLNMCGAVHCSDIAILGYHRKPPVIDHEWLDNLCEIPLAVAACPVGAIRPTKKEIVTEKGETKTVNTVAIKNERCMFCGNCYTMCPSLPLSDQTGDGLVIMAGGKVSNRISNPKFSKVVVAFIPNEPPRWPRLASVIRQIVEAYAADARKYERVGDWAERIGWERFFEKCELDFSIHMIDDFRDPAYYTWRQTTNFKF 386
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381     


Chain C from PDB  Type:PROTEIN  Length:104
 aligned with C7LV29_DESBD | C7LV29 from UniProtKB/TrEMBL  Length:105

    Alignment length:104
                                    11        21        31        41        51        61        71        81        91       101    
         C7LV29_DESBD     2 AMIEFKGKSFEIDEDGFLLKFEDWGPEWAEYVKESEGISEITEAHQQILDFLQDYYKKNGIAPMVRILSKSTGYKLKQIYELFPSGPGKGACKMAGLPKPTGCV 105
               SCOP domains d2xsjc_ C: automated matches                                                                             SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..eeee........hhhhh..hhhhhhh........hhhhhhhhhhhhhhhhhhh...hhhhhhhhhh.hhhhhhhhh.hhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 2xsj C   2 AMIEFKGKSFEIDEDGFLLKFEDWGPEWAEYVKESEGISEITEAHQQILDFLQDYYKKNGIAPMVRILSKSTGYKLKQIYELFPSGPGKGACKMAGLPKPTGCV 105
                                    11        21        31        41        51        61        71        81        91       101    


Chain D from PDB  Type:PROTEIN  Length:436
 aligned with Q93UT1_DESNO | Q93UT1 from UniProtKB/TrEMBL  Length:375

    Alignment length:436
                                                                                         1                                                                                                                                                                                                                                                                                                                                                                                      
                                     -         -         -         -         -         - |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369      
         Q93UT1_DESNO     - -------------------------------------------------------------THWKHGGIVGVFGYGGGVIGRYCDQPQMFPGVAHFHTVRVAQPAGMYYTTDFLKQLCDLWDMRGSGLTNMHGATGDIVLLGTTTPQLEEFYFELTHKMNNDLGGSGSNLRTPASCLGDSRCEWACYDAQELCYQMTQEYQDELHRPAFPYKFKFKFDGCPNGCVASIARSDMSFIGTWRDDIRIDQEAVAAYVGGEIQPNGGAHSGKDWGAFDIQKEVIDLCPTECMWMEDGKLQINNRECTRCMHCLNVMPRALRIGNDRGLSILVGAKAPILDGAQMGSLLVPFIKVEDPYDEIKEIIEGIWEWWMEEGKNRERLGELIKRQGLAKAIAAVGLTPVPQHVMEPRHNPYIFWKEKDVEGGWDRDIADYRKHHQR 375
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhh....hhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhh..................ee.........hhhhh...eeee......eeehhhhhhhhhhhhhhh..eee.......eeee....hhhhhhhhhhhhhhh.............ee.hhhhh......hhhhhhhhhhhhhhhhhhh........eeee.......hhhhhh.eeeeeee....eehhhhhhhhhh...hhhhhh.........hhhhhh........eeee..eeee.hhhh...hhhhhhh...ee....eeeeeee.............eeeeeee.....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh....hhhh............hhhhh......hhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2xsj D   2 AKHATPLLDQLQSGPWPSFVADIKEEAERRHSNQDNVEYQIPVDVCDDLLGILELKYSDGTTHWKHGGIVGVFGYGGGVIGRYCDQPQMFPGVAHFHTVRVAQPAGMYYTTDFLKQLCDLWDMRGSGLTNMHGATGDIVLLGTTTPQLEEFYFELTHKMNNDLGGSGSNLRTPASCLGDSRCEWACYDAQELCYQMTQEYQDELHRPAFPYKFKFKFDGCPNGCVASIARSDMSFIGTWRDDIRIDQEAVAAYVGGEIQPNGGAHSGKDWGAFDIQKEVIDLCPTECMWMEDGKLQINNRECTRCMHCLNVMPRALRIGNDRGLSILVGAKAPILDGAQMGSLLVPFIKVEDPYDEIKEIIEGIWEWWMEEGKNRERLGELIKRQGLAKAIAAVGLTPVPQHVMEPRHNPYIFWKEKDVEGGWDRDIADYRKHHQR 437
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431      


Chain E from PDB  Type:PROTEIN  Length:385
 aligned with Q93UT0_DESNO | Q93UT0 from UniProtKB/TrEMBL  Length:271

    Alignment length:385
                                                                                                                                                                                                                                                                                                       271                                                                                                                   
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271         -         -         -         -         -         -         -         -         -         -         -     
         Q93UT0_DESNO     2 AFVSSGYNPEKPMENRISDIGPRHASDFFPPVIAKNKGQWLWHEICEPGILMHKAESGDEVYTVRCGGARLMSVGHIREICAIADKFCGGHLRFTTRNNIEFMVTTLDEAKKLKEYLNAQKFEGGSFKFPVGGTGAGITNIVHTQGWVHCHTPATDASGTVKVVLDELFEEFGQMRMPAQVRISMACCLNMCGAVHCSDIAILGYHRKPPVIDHEWLDNLCEIPLAVAACPVGAIRPTKKEIVTEKGETKTVNTVAIKNERCMFCGNCYT-------------------------------------------------------------------------------------------------------------------   -
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......................hhhhh.hhhhhhhh..eeeeeeee..eeeeee....eeeeeee....eeehhhhhhhhhhhhhhh..eeee.....eeeee.hhhhhhhhhhhhh..........................hhhhh......hhhhhhhhhhhhhhhhh..........eeee.......hhhhh.eeeeee.......hhhhhhhhhhhhhhhhh.....eeeeeeeee.....eeeeeeeee.hhhh...hhhhhhh...........eeeeee..............eeeeeeee.....hhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh....hhhhh.....hhhhhh........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2xsj E   2 AFVSSGYNPEKPMENRISDIGPRHASDFFPPVIAKNKGQWLWHEICEPGILMHKAESGDEVYTVRCGGARLMSVGHIREICAIADKFCGGHLRFTTRNNIEFMVTTLDEAKKLKEYLNAQKFEGGSFKFPVGGTGAGITNIVHTQGWVHCHTPATDASGTVKVVLDELFEEFGQMRMPAQVRISMACCLNMCGAVHCSDIAILGYHRKPPVIDHEWLDNLCEIPLAVAACPVGAIRPTKKEIVTEKGETKTVNTVAIKNERCMFCGNCYTMCPSLPLSDQTGDGLVIMAGGKVSNRISNPKFSKVVVAFIPNEPPRWPRLASVIRQIVEAYAADARKYERVGDWAERIGWERFFEKCELDFSIHMIDDFRDPAYYTWRQTTNFKF 386
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381     


Chain F from PDB  Type:PROTEIN  Length:104
 aligned with C7LV29_DESBD | C7LV29 from UniProtKB/TrEMBL  Length:105

    Alignment length:104
                                    11        21        31        41        51        61        71        81        91       101    
         C7LV29_DESBD     2 AMIEFKGKSFEIDEDGFLLKFEDWGPEWAEYVKESEGISEITEAHQQILDFLQDYYKKNGIAPMVRILSKSTGYKLKQIYELFPSGPGKGACKMAGLPKPTGCV 105
               SCOP domains d2xsjf_ F: automated matches                                                                             SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..eeee........hhhhh..hhhhhhh........hhhhhhhhhhhhhhhhhhh...hhhhhhhhhh.hhhhhhhhh.hhhhhhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 2xsj F   2 AMIEFKGKSFEIDEDGFLLKFEDWGPEWAEYVKESEGISEITEAHQQILDFLQDYYKKNGIAPMVRILSKSTGYKLKQIYELFPSGPGKGACKMAGLPKPTGCV 105
                                    11        21        31        41        51        61        71        81        91       101
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2XSJ)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2XSJ)

(-) Gene Ontology  (7, 14)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,D   (Q93UT1_DESNO | Q93UT1)
molecular function
    GO:0051539    4 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0018551    hydrogensulfite reductase activity    Catalysis of the reaction: trithionate + acceptor + 2 H2O + OH- = 3 HSO3- + reduced acceptor.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain B,E   (Q93UT0_DESNO | Q93UT0)
molecular function
    GO:0051539    4 iron, 4 sulfur cluster binding    Interacting selectively and non-covalently with a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0051536    iron-sulfur cluster binding    Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain C,F   (C7LV29_DESBD | C7LV29)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SF4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO3  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SRM  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    BC1  [ RasMol ]  +environment [ RasMol ]
    BC2  [ RasMol ]  +environment [ RasMol ]
    BC3  [ RasMol ]  +environment [ RasMol ]
    BC4  [ RasMol ]  +environment [ RasMol ]
    BC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asp A:353 - Pro A:354   [ RasMol ]  
    Asp D:353 - Pro D:354   [ RasMol ]  
    Ile A:335 - Leu A:336   [ RasMol ]  
    Ile D:335 - Leu D:336   [ RasMol ]  
    Met A:132 - His A:133   [ RasMol ]  
    Met D:132 - His D:133   [ RasMol ]  
    Pro B:315 - Pro B:316   [ RasMol ]  
    Pro E:315 - Pro E:316   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2xsj
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  C7LV29_DESBD | C7LV29
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q93UT0_DESNO | Q93UT0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q93UT1_DESNO | Q93UT1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.8.99.3
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  C7LV29_DESBD | C7LV29
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q93UT0_DESNO | Q93UT0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q93UT1_DESNO | Q93UT1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2XSJ)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2XSJ)