|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 3)| Asymmetric/Biological Unit (3, 3) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2XOD) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2XOD) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2XOD) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2XOD) |
Exons (0, 0)| (no "Exon" information available for 2XOD) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:118 aligned with Q81TB7_BACAN | Q81TB7 from UniProtKB/TrEMBL Length:119 Alignment length:118 10 20 30 40 50 60 70 80 90 100 110 Q81TB7_BACAN 1 MLVAYDSMTGNVKRFIHKLNMPAVQIGEDLVIDEDFILITYTTGFGNVPERVLEFLERNNEKLKGVSASGNRNWGDMFGASADKISAKYEVPIVSKFELSGTNNDVEYFKERVREIAT 118 SCOP domains ---------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains 2xodA00 A:1-118 [code=3.40.50.360, no name defined] CATH domains Pfam domains --Flavodoxin_NdrI-2xodA01 A:3-111 ------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript 2xod A 1 MLVAYDSMTGNVKRFIHKLNMPAVQIGEDLVIDEDFILITYTTGFGNVPERVLEFLERNNEKLKGVSASGNRNWGDMFGASADKISAKYEVPIVSKFELSGTNNDVEYFKERVREIAT 118 10 20 30 40 50 60 70 80 90 100 110
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2XOD) |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q81TB7_BACAN | Q81TB7)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|