Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE UNC18-SYNTAXIN 1 COMPLEX FROM MONOSIGA BREVICOLLIS
 
Authors :  P. Burkhardt, C. M. Stegmann, M. C. Wahl, D. Fasshauer
Date :  14 Jun 10  (Deposition) - 29 Jun 11  (Release) - 14 Mar 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Exocytosis, Exocytosis Complex, Snare, Neuro Fusion, Sm Protein, Choanoflagellates (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. Burkhardt, C. M. Stegmann, B. Cooper, T. H. Kloepper, C. Imig, F. Varoqueaux, M. C. Wahl, D. Fasshauer
Primordial Neurosecretory Apparatus Identified In The Choanoflagellate Monosiga Brevicollis.
Proc. Natl. Acad. Sci. Usa V. 108 15264 2011
PubMed-ID: 21876177  |  Reference-DOI: 10.1073/PNAS.1106189108

(-) Compounds

Molecule 1 - UNC18
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Organism Scientific: MONOSIGA BREVICOLLIS
    Organism Taxid: 81824
 
Molecule 2 - SYNTAXIN1
    Chains: B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Organism Scientific: MONOSIGA BREVICOLLIS
    Organism Taxid: 81824

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2XHE)

(-) Sites  (0, 0)

(no "Site" information available for 2XHE)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2XHE)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2XHE)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2XHE)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2XHE)

(-) Exons   (0, 0)

(no "Exon" information available for 2XHE)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:567
 aligned with A9V0L3_MONBE | A9V0L3 from UniProtKB/TrEMBL  Length:649

    Alignment length:618
                             1                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                        
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579       589       599       609        
         A9V0L3_MONBE     - -MSLKSAVKTVLTNSLRSVADGGDWKVLVVDKPALRMISECARMSEILDLGVTVVEDVSKQRKVLPQFHGVYFIEPTEENLDYVIRDFADRTPTYEAAHLFFLSPVPDALMAKLASAKAVKYVKTLKEINTLFIPKEHRVFTLNEPHGLVQYYGSRSSSYNIDHLVRRLSTLCTTMNVAPIVRYSSTSTPGTERMAMQLQKEIDMSVSQGLINAREGKLKSQFLILDRAVDLKSPLVHELTYQAAAYDLLNIENDIYSYSTVDAGGREQQRQVVLGEDDDIWLQMRHLHISEVFRKVKSSFDEFCVSARRLQGLRDSQQGEGGAGALKQMLKDLPQHREQMQKYSLHLDMSNAINMAFSSTIDSCTKAEQNIVTEEEQDGNKVRDFIGEVASVVVDRRVSTEDKLRCLMLCVLAKNGTSSHELNNLLDNANIATPSRSAIYNLEMLGATVVADRRGRKPKTMKRIERDMPYVLSRWTPIVKDLMEYIATGQLDLESYPAVRDGPSVVQPKRASKSVEEDDDGPATSARKRGNWAKNKGNNRSLPSTPSGVAVSGNGAAGAAESAKPKLFVFINGTVSYNEIRCAYEVSQSSGYEVYIGAHNIATPAEFVELVSLLDKA 617
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------Sec1-2xheA01 A:24-611                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       ------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh........eeeeehhhhhhhhhh..hhhhhhh..eeeeee...........eeeeee..hhhhhhhhhhhhhh.......eeeee....hhhhhhhhhhhhhhh.eeeeee.....eeee..eee....hhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh...eeee....hhhhhhhhhhhhhhhhhhhh.............eeeeehhhhh.........hhhhhhhhhh.....eeeeee.......eeeeee......hhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhh..hhhhhhhhhhhhhhh....hhhh......................hhhhhhhhhhh.............hhhhh....---------------------------------------------------.....eeeeeeeeeehhhhhhhhhhhhh....eeeeeeeee.hhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2xhe A   0 HMSLKSAVKTVLTNSLRSVADGGDWKVLVVDKPALRMISECARMSEILDLGVTVVEDVSKQRKVLPQFHGVYFIEPTEENLDYVIRDFADRTPTYEAAHLFFLSPVPDALMAKLASAKAVKYVKTLKEINTLFIPKEHRVFTLNEPHGLVQYYGSRSSSYNIDHLVRRLSTLCTTMNVAPIVRYSSTSTPGTERMAMQLQKEIDMSVSQGLINAREGKLKSQFLILDRAVDLKSPLVHELTYQAAAYDLLNIENDIYSYSTVDAGGREQQRQVVLGEDDDIWLQMRHLHISEVFRKVKSSFDEFCVSARRLQGLRDSQQGEGGAGALKQMLKDLPQHREQMQKYSLHLDMSNAINMAFSSTIDSCTKAEQNIVTEEEQDGNKVRDFIGEVASVVVDRRVSTEDKLRCLMLCVLAKNGTSSHELNNLLDNANIATPSRSAIYNLEMLGATVVADRRGRKPKTMKRIERDMPYVLSRWTPIVKDLMEYIATGQLDLESYPAVRDGPSVVQPK---------------------------------------------------ESAKPKLFVFINGTVSYNEIRCAYEVSQSSGYEVYIGAHNIATPAEFVELVSLLDKA 617
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509         -         -         -         -         - |     569       579       589       599       609        
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       509                                                 561                                                        


Chain B from PDB  Type:PROTEIN  Length:220
 aligned with A9UTG5_MONBE | A9UTG5 from UniProtKB/TrEMBL  Length:304

    Alignment length:260
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261
         A9UTG5_MONBE     2 DRLSRLRQMAAENQPAEASDAAGGAEAQIEETSLSAQPEPFMADFFNRVKRIRDNIEDIEQAIEQVAQLHTESLVAVSKEDRDRLNEKLQDTMARISALGNKIRADLKQIEKENKRAQQEGTFEDGTVSTDLRIRQSQHSSLSRKFVKVMTRYNDVQAENKRRYGENVARQCRVVEPSLSDDAIQKVIEHGTEGIFSGMRLEGAEAKLNEIRDRHKDIQQLERSLLELHEMFTDMSTLVASQGEMIDRIEFSVEQSHNYV 261
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------Syntaxin-2xheB02 B:42-151                                                                                     --------------------------------------------------------------SNARE-2xheB01 B:214-261                          Pfam domains
         Sec.struct. author ..hhhhhhh.....-----------------------....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhh-----------------...hhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2xhe B   2 DRLSRLRQMAAENQ-----------------------PEPFMADFFNRVKRIRDNIEDIEQAIEQVAQLHTESLVAVSKEDRDRLNEKLQDTMARISALGNKIRADLKQIEKENKRAQQEGTFEDGTVSTDLRIRQSQHSSLSRKFVKVMTRYNDVQAENKRRYGENVARQCRVVEPSLSDDAIQKVIEHG-----------------NEIRDRHKDIQQLERSLLELHEMFTDMSTLVASQGEMIDRIEFSVEQSHNYV 261
                                    11   |     -         -       |41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191|        -       211       221       231       241       251       261
                                        15                      39                                                                                                                                                      192               210
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2XHE)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2XHE)

(-) Pfam Domains  (3, 3)

Asymmetric/Biological Unit
(-)
Clan: SNARE-fusion (10)
(-)
Clan: no clan defined [family: Sec1] (5)

(-) Gene Ontology  (13, 14)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (A9V0L3_MONBE | A9V0L3)
biological process
    GO:0006904    vesicle docking involved in exocytosis    The initial attachment of a vesicle membrane to a target membrane, mediated by proteins protruding from the membrane of the vesicle and the target membrane, that contributes to exocytosis.
    GO:0016192    vesicle-mediated transport    A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane.

Chain B   (A9UTG5_MONBE | A9UTG5)
molecular function
    GO:0005484    SNAP receptor activity    Acting as a marker to identify a membrane and interacting selectively with one or more SNAREs on another membrane to mediate membrane fusion.
    GO:0000149    SNARE binding    Interacting selectively and non-covalently with a SNARE (soluble N-ethylmaleimide-sensitive factor attached protein receptor) protein.
biological process
    GO:0006887    exocytosis    A process of secretion by a cell that results in the release of intracellular molecules (e.g. hormones, matrix proteins) contained within a membrane-bounded vesicle. Exocytosis can occur either by full fusion, when the vesicle collapses into the plasma membrane, or by a kiss-and-run mechanism that involves the formation of a transient contact, a pore, between a granule (for exemple of chromaffin cells) and the plasma membrane. The latter process most of the time leads to only partial secretion of the granule content. Exocytosis begins with steps that prepare vesicles for fusion with the membrane (tethering and docking) and ends when molecules are secreted from the cell.
    GO:0006886    intracellular protein transport    The directed movement of proteins in a cell, including the movement of proteins between specific compartments or structures within a cell, such as organelles of a eukaryotic cell.
    GO:0048278    vesicle docking    The initial attachment of a transport vesicle membrane to the target membrane, mediated by proteins protruding from the membrane of the vesicle and the target membrane. Docking requires only that the two membranes come close enough for these proteins to interact and adhere.
    GO:0006906    vesicle fusion    Fusion of the membrane of a transport vesicle with its target membrane.
    GO:0016192    vesicle-mediated transport    A cellular transport process in which transported substances are moved in membrane-bounded vesicles; transported substances are enclosed in the vesicle lumen or located in the vesicle membrane. The process begins with a step that directs a substance to the forming vesicle, and includes vesicle budding and coating. Vesicles are then targeted to, and fuse with, an acceptor membrane.
cellular component
    GO:0031201    SNARE complex    A protein complex involved in membrane fusion; a stable ternary complex consisting of a four-helix bundle, usually formed from one R-SNARE and three Q-SNAREs with an ionic layer sandwiched between hydrophobic layers. One well-characterized example is the neuronal SNARE complex formed of synaptobrevin 2, syntaxin 1a, and SNAP-25.
    GO:0012505    endomembrane system    A collection of membranous structures involved in transport within the cell. The main components of the endomembrane system are endoplasmic reticulum, Golgi bodies, vesicles, cell membrane and nuclear envelope. Members of the endomembrane system pass materials through each other or though the use of vesicles.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2xhe)
 
  Sites
(no "Sites" information available for 2xhe)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2xhe)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2xhe
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A9UTG5_MONBE | A9UTG5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  A9V0L3_MONBE | A9V0L3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A9UTG5_MONBE | A9UTG5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  A9V0L3_MONBE | A9V0L3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2XHE)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2XHE)