![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2X9C) |
(no "Site" information available for 2X9C) |
(no "SS Bond" information available for 2X9C) |
(no "Cis Peptide Bond" information available for 2X9C) |
(no "SAP(SNP)/Variant" information available for 2X9C) |
(no "PROSITE Motif" information available for 2X9C) |
(no "Exon" information available for 2X9C) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:62 aligned with PRGI_SALTY | P41784 from UniProtKB/Swiss-Prot Length:80 Alignment length:62 28 38 48 58 68 78 PRGI_SALTY 19 GVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR 80 SCOP domains d2x9ca_ A: automated matches SCOP domains CATH domains -------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------- Transcript 2x9c A 19 GVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTAKAFKDIDAAIIQNFR 80 28 38 48 58 68 78 Chain B from PDB Type:PROTEIN Length:63 aligned with PRGI_SALTY | P41784 from UniProtKB/Swiss-Prot Length:80 Alignment length:63 27 37 47 57 67 77 PRGI_SALTY 18 TGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR 80 SCOP domains d2x9cb_ B: automated matches SCOP domains CATH domains --------------------------------------------------------------- CATH domains Pfam domains (1) MxiH-2x9cB01 B:18-79 - Pfam domains (1) Pfam domains (2) MxiH-2x9cB02 B:18-79 - Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------- Transcript 2x9c B 18 TGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTAKAFKDIDAAIIQNFR 80 27 37 47 57 67 77
|
Asymmetric Unit
|
(no "CATH Domain" information available for 2X9C) |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (PRGI_SALTY | P41784)
|
|
|
|
|
|
|