Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HYPOTHETICAL PROTEIN SSO1986 FROM SULFOLOBUS SOLFATARICUS P2
 
Authors :  M. Oke, L. Carter, K. A. Johnson, M. Kerou, H. Liu, S. Mcmahon, J. H. Naism M. F. White
Date :  10 Feb 10  (Deposition) - 28 Jul 10  (Release) - 28 Jul 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.05
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Oke, L. G. Carter, K. A. Johnson, H. Liu, S. A. Mcmahon, X. Yan, M. Kerou, N. D. Weikart, N. Kadi, M. A. Sheikh, S. Schmelz, M. Dorward, M. Zawadzki, C. Cozens, H. Falconer, H. Powers, I. M. Overton, C. A. J. Van Niekerk, X. Peng, P. Patel, R. A. Garrett, D. Prangishvili C. H. Botting, P. J. Coote, D. T. F. Dryden, G. J. Barton, U. Schwarz-Linek, G. L. Challis, G. L. Taylor, M. F. White, J. H. Naismith
The Scottish Structural Proteomics Facility: Targets, Methods And Outputs.
J. Struct. Funct. Genomics V. 11 167 2010
PubMed-ID: 20419351  |  Reference-DOI: 10.1007/S10969-010-9090-Y

(-) Compounds

Molecule 1 - SSO1986
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PDEST14
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Scientific: SULFOLOBUS SOLFATARICUS
    Organism Taxid: 273057
    Strain: P2

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2X5Q)

(-) Sites  (0, 0)

(no "Site" information available for 2X5Q)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2X5Q)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2X5Q)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2X5Q)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2X5Q)

(-) Exons   (0, 0)

(no "Exon" information available for 2X5Q)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:183
 aligned with CMR7A_SULSO | Q97WX5 from UniProtKB/Swiss-Prot  Length:197

    Alignment length:190
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196
          CMR7A_SULSO     7 WEEQVFLPITNSISSEDNNQIKIGSSVSIEYNQNGQHVSQIDDKGLHNILVLTGYAIDESTGELVPTFDPCDYVKGILISGKILKGNHFKIIGIPSNKLYIIRKKDVHGNITFSLPIKNFNTGTYQVDLRDKVTSFVSLDRDVAKTIVDNVLAKIYAKIYNSLNKEQKDKLYRDVEEIFNYYSIKSLKSN 196
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.....eee...eee.....eeee........eee..eee.eeeee.eeee....eeee......eeeeeeeeeeeee..eeeeeeee.hhh.ee.......eeeeeee..-------.ee...eeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2x5q A   7 WEEQVFLPITNSISSEDNNQIKIGSSVSIEYNQNGQHVSQIDDKGLHNILVLTGYAIDESTGELVPTFDPCDYVKGILISGKILKGNHFKIIGIPSNKLYIIRKKDVHGNITFSLPIK-------QVDLRDKVTSFVSLDRDVAKTIVDNVLAKIYAKIYNSLNKEQKDKLYRDVEEIFNYYSIKSLKSN 196
                                    16        26        36        46        56        66        76        86        96       106       116       | -     | 136       146       156       166       176       186       196
                                                                                                                                               124     132                                                                


Chain B from PDB  Type:PROTEIN  Length:180
 aligned with CMR7A_SULSO | Q97WX5 from UniProtKB/Swiss-Prot  Length:197

    Alignment length:186
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186      
          CMR7A_SULSO     7 WEEQVFLPITNSISSEDNNQIKIGSSVSIEYNQNGQHVSQIDDKGLHNILVLTGYAIDESTGELVPTFDPCDYVKGILISGKILKGNHFKIIGIPSNKLYIIRKKDVHGNITFSLPIKNFNTGTYQVDLRDKVTSFVSLDRDVAKTIVDNVLAKIYAKIYNSLNKEQKDKLYRDVEEIFNYYSIKS 192
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...eeeee.....eee...eee.....eeee........eee..eee.eeeee.eeee....eeee......eeeeeeeeeeeee.eeeeeeeee.hhh.ee.......eeeeeeee------..eee....eeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhheeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2x5q B   7 WEEQVFLPITNSISSEDNNQIKIGSSVSIEYNQNGQHVSQIDDKGLHNILVLTGYAIDESTGELVPTFDPCDYVKGILISGKILKGNHFKIIGIPSNKLYIIRKKDVHGNITFSLPI------TYQVDLRDKVTSFVSLDRDVAKTIVDNVLAKIYAKIYNSLNKEQKDKLYRDVEEIFNYYSIKS 192
                                    16        26        36        46        56        66        76        86        96       106       116      |  -   |   136       146       156       166       176       186      
                                                                                                                                              123    130
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2X5Q)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2X5Q)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2X5Q)

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (CMR7A_SULSO | Q97WX5)
biological process
    GO:0050688    regulation of defense response to virus    Any process that modulates the frequency, rate or extent of the antiviral response of a cell or organism.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2x5q)
 
  Sites
(no "Sites" information available for 2x5q)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2x5q)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2x5q
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CMR7A_SULSO | Q97WX5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CMR7A_SULSO | Q97WX5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2X5Q)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2X5Q)