Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF DESE, A FERRIC-SIDEROPHORE RECEPTOR PROTEIN FROM STREPTOMYCES COELICOLOR
 
Authors :  M. Oke, L. G. Carter, K. A. Johnson, H. Liu, S. A. Mcmahon, M. F. White, J. H. Naismith
Date :  01 Feb 10  (Deposition) - 21 Jul 10  (Release) - 21 Jul 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A
Keywords :  Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Oke, L. G. Carter, K. A. Johnson, H. Liu, S. A. Mcmahon, X. Yan, M. Kerou, N. D. Weikart, N. Kadi, M. A. Sheikh, S. Schmelz, M. Dorward, M. Zawadzki, C. Cozens, H. Falconer, H. Powers, I. M. Overton, C. A. J. Van Niekerk, X. Peng, P. Patel, R. A. Garrett, D. Prangishvili C. H. Botting, P. J. Coote, D. T. F. Dryden, G. J. Barton, U. Schwarz-Linek, G. L. Challis, G. L. Taylor, M. F. White, J. H. Naismith
The Scottish Structural Proteomics Facility: Targets, Methods And Outputs.
J. Struct. Funct. Genomics V. 11 167 2010
PubMed-ID: 20419351  |  Reference-DOI: 10.1007/S10969-010-9090-Y

(-) Compounds

Molecule 1 - FERRIC-SIDEROPHORE RECEPTOR PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET151
    Expression System Strain: C43(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: RESIDUES 33-349
    Organism Scientific: STREPTOMYCES COELICOLOR
    Organism Taxid: 100226
    Strain: A3(2)

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2X4L)

(-) Sites  (0, 0)

(no "Site" information available for 2X4L)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2X4L)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2X4L)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2X4L)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2X4L)

(-) Exons   (0, 0)

(no "Exon" information available for 2X4L)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:298
 aligned with Q9L074_STRCO | Q9L074 from UniProtKB/TrEMBL  Length:349

    Alignment length:298
                                    61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341        
         Q9L074_STRCO    52 PWSFKDDRGTTVKLDKVPANIVAFTGVAAALFDYGVEVKGVFGPTTTKDGKPDVQAGDLDVDKVTVLGNEWGKLNVEKYASLAPEVLITTTFDTAGTLWSVPEESKDKVAKLAPSVAISVFDRQLTQPLQRMWELAESLGADMKAKKVTDAKAAFDKAAARLRAAAKAKPEIRVLAGSASPDLFYVSGTNLSVDLEYFKALGVNFVEPSEDAKKATGGWFESLSWENVDKYPADVIIMDDRASTIQPADITEGTWKQLPAVKAGQVIARSPEPILSYDKCTPLLDNLAEAIENAKKVG 349
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------Peripla_BP_2-2x4lA01 A:72-323                                                                                                                                                                                                                               -------------------------- Pfam domains
         Sec.struct. author .eeee.....eeee......eeeehhhhhhhhhh.....eee..........hhhhh.......eeee......hhhhhhhh...eeeeee..........hhhhhhhhhhhh.eeeee.....hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeee...eeeee....hhhhhhhhhh..ee.......hhhhh..eeeee.hhh......eeeee......hhhhh.hhhhhhhhhhhh..eeee......hhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2x4l A  52 PWSFKDDRGTTVKLDKVPANIVAFTGVAAALFDYGVEVKGVFGPTTTKDGKPDVQAGDLDVDKVTVLGNEWGKLNVEKYASLAPEVLITTTFDTAGTLWSVPEESKDKVAKLAPSVAISVFDRQLTQPLQRMWELAESLGADMKAKKVTDAKAAFDKAAARLRAAAKAKPEIRVLAGSASPDLFYVSGTNLSVDLEYFKALGVNFVEPSEDAKKATGGWFESLSWENVDKYPADVIIMDDRASTIQPADITEGTWKQLPAVKAGQVIARSPEPILSYDKCTPLLDNLAEAIENAKKVG 349
                                    61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2X4L)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2X4L)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2X4L)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2x4l)
 
  Sites
(no "Sites" information available for 2x4l)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2x4l)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2x4l
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9L074_STRCO | Q9L074
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9L074_STRCO | Q9L074
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2X4L)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2X4L)