![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (3, 8) Biological Unit 1 (2, 9) |
Asymmetric Unit (8, 8)
|
(no "SS Bond" information available for 2X4K) |
(no "Cis Peptide Bond" information available for 2X4K) |
(no "SAP(SNP)/Variant" information available for 2X4K) |
(no "PROSITE Motif" information available for 2X4K) |
(no "Exon" information available for 2X4K) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:62 aligned with Q33C63_STAAU | Q33C63 from UniProtKB/TrEMBL Length:62 Alignment length:62 1 | 9 19 29 39 49 59 Q33C63_STAAU - -MMPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRKSD 61 SCOP domains d2x4ka_ A: automated matches SCOP domains CATH domains -------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------- Transcript 2x4k A 0 SMMPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRKSD 61 9 19 29 39 49 59 Chain A from PDB Type:PROTEIN Length:62 aligned with Y1376_STAAR | Q6GH41 from UniProtKB/Swiss-Prot Length:61 Alignment length:62 1 | 8 18 28 38 48 58 Y1376_STAAR - --MPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRKSD 60 SCOP domains d2x4ka_ A: automated matches SCOP domains CATH domains -------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------- Transcript 2x4k A 0 SMMPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRKSD 61 9 19 29 39 49 59 Chain B from PDB Type:PROTEIN Length:62 aligned with Q33C63_STAAU | Q33C63 from UniProtKB/TrEMBL Length:62 Alignment length:62 1 | 9 19 29 39 49 59 Q33C63_STAAU - -MMPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRKSD 61 SCOP domains d2x4kb_ B: automated matches SCOP domains CATH domains -------------------------------------------------------------- CATH domains Pfam domains (1) ---Tautomerase-2x4kB01 B:3-61 Pfam domains (1) Pfam domains (2) ---Tautomerase-2x4kB02 B:3-61 Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------- Transcript 2x4k B 0 SMMPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRKSD 61 9 19 29 39 49 59 Chain B from PDB Type:PROTEIN Length:62 aligned with Y1376_STAAR | Q6GH41 from UniProtKB/Swiss-Prot Length:61 Alignment length:62 1 | 8 18 28 38 48 58 Y1376_STAAR - --MPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRKSD 60 SCOP domains d2x4kb_ B: automated matches SCOP domains CATH domains -------------------------------------------------------------- CATH domains Pfam domains (1) ---Tautomerase-2x4kB01 B:3-61 Pfam domains (1) Pfam domains (2) ---Tautomerase-2x4kB02 B:3-61 Pfam domains (2) SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------- Transcript 2x4k B 0 SMMPIVNVKLLEGRSDEQLKNLVSEVTDAVEKTTGANRQAIHVVIEEMKPNHYGVAGVRKSD 61 9 19 29 39 49 59
|
Asymmetric Unit
|
(no "CATH Domain" information available for 2X4K) |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (Y1376_STAAR | Q6GH41)
Chain A,B (Q33C63_STAAU | Q33C63)
|
|
|
|
|
|
|