Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF SEMET ARG R 1
 
Authors :  G. C. Paesen, C. Siebold, N. Syme, K. Harlos, S. C. Graham, C. Hilger, S. W F. Hentges, D. I. Stuart
Date :  28 Jan 10  (Deposition) - 09 Feb 11  (Release) - 09 Feb 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.00
Chains :  Asym./Biol. Unit :  A
Keywords :  Allergen (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. C. Paesen, C. Siebold, N. Syme, K. Harlos, S. C. Graham, C. Hilger, S. W. Homans, F. Hentges, D. I. Stuart
Crystal Structure Of The Allergen Arg R 1, A Histamine-Binding Lipocalin From A Soft Tick
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - ALLERGEN ARG R 1
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: ORIGAMI(DE3)PLYSS
    Expression System Taxid: 562
    Expression System Vector: PET-23A
    Expression System Vector Type: PLASMID
    Mutation: YES
    Organ: SALIVARY GLAND
    Organism Common: EUROPEAN PIGEON TICK
    Organism Scientific: ARGAS REFLEXUS
    Organism Taxid: 34604

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric/Biological Unit (2, 4)
No.NameCountTypeFull Name
1MSE3Mod. Amino AcidSELENOMETHIONINE
2TRS1Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:28 , TYR A:37 , VAL A:53 , TYR A:67 , ILE A:92 , ASP A:110 , TRP A:121 , HOH A:2289 , HOH A:2290 , HOH A:2291 , HOH A:2292BINDING SITE FOR RESIDUE TRS A1160

(-) SS Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1A:19 -A:134
2A:50 -A:155
3A:109 -A:135

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2X46)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2X46)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2X46)

(-) Exons   (0, 0)

(no "Exon" information available for 2X46)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:144
 aligned with ARGR1_ARGRF | Q5GQ85 from UniProtKB/Swiss-Prot  Length:159

    Alignment length:144
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155    
          ARGR1_ARGRF    16 ADDCSGKTDAWTSIKGPKTGGYWLKQTTKTGENECTYVKGTDFKENTKTATYTYGYKDASGKLTKTTGTATAKGSDIVVGSDTSTVIYTDGKTCDVVKHGGHTELWVHSSKTSGGYNNCCDKKFTETRGSTPANEVYKKCPGMP 159
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ----His_binding-2x46A01 A:20-142                                                                                               ----------------- Pfam domains
         Sec.struct. author ........hhhhhhhh.....eeeeee.........eeeeeeee....eeeeeee..........eeeeeeee..eeee..eeeeeeee....eeeeee..eeeeeee.hhh.....hhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2x46 A  16 mDDCSGKTDAWTSIKGPKTGGYWLKQTTKTGENECTYVKGTDFKENTKTATYTYGYKDASGKLTKTTGTAmAKGSDIVVGSDTSTVIYTDGKTCDVVKHGGHTELWVHSSKTSGGYNNCCDKKFTETRGSTPANEVYKKCPGmP 159
                            |       25        35        45        55        65        75        85|       95       105       115       125       135       145       155  | 
                            |                                                                    86-MSE                                                                 158-MSE
                           16-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2X46)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2X46)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: Calycin (163)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (ARGR1_ARGRF | Q5GQ85)
molecular function
    GO:0043176    amine binding    Interacting selectively and non-covalently with any organic compound that is weakly basic in character and contains an amino or a substituted amino group.
biological process
    GO:0030682    evasion or tolerance of host defense response    Any process, either active or passive, by which an organism avoids or tolerates the effects of its host organism's defense response. The host defense response is mounted by the host in response to the presence of the organism. The host is defined as the larger of the organisms involved in a symbiotic interaction.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TRS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2x46)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2x46
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ARGR1_ARGRF | Q5GQ85
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ARGR1_ARGRF | Q5GQ85
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ARGR1_ARGRF | Q5GQ85: 2x45

(-) Related Entries Specified in the PDB File

2x45 CRYSTAL STRUCTURE OF ARG R 1 IN COMPLEX WITH HISTAMINE