2WY3 - JenaLib

Asymmetric Unit (14, 14)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ASP A:52 , ASN B:84 , SER B:86 , HOH B:2162 , HOH B:2163 , HOH B:2164 , GLN D:82 , HIS D:83 , HOH D:2072	BINDING SITE FOR RESIDUE NAG B1203
02	AC2	SOFTWARE	GLU B:71 , ASN B:95	BINDING SITE FOR RESIDUE NAG B1204
03	AC3	SOFTWARE	ILE B:99 , ASN B:101 , ILE B:105 , HOH B:2107 , HOH B:2166 , HOH B:2168	BINDING SITE FOR RESIDUE NAG B1205
04	AC4	SOFTWARE	ASN B:132 , HOH B:2169 , HOH B:2170 , HOH B:2171 , HOH B:2172 , HOH B:2173 , TRP D:81 , VAL D:87 , ASP D:104 , PEU D:1160 , HOH D:2104	BINDING SITE FOR RESIDUE NAG B1206
05	AC5	SOFTWARE	GLN B:82 , HIS B:83 , ASN D:84 , SER D:86 , VAL D:87 , HOH D:2077 , HOH D:2159 , HOH D:2160 , HOH D:2161 , HOH D:2162	BINDING SITE FOR RESIDUE NAG D1203
06	AC6	SOFTWARE	ASN A:113 , GLU A:115 , ARG A:134 , GLU D:71 , ASN D:95 , HOH D:2093 , HOH D:2163 , HOH D:2164 , HOH D:2165	BINDING SITE FOR RESIDUE NAG D1204
07	AC7	SOFTWARE	SER A:133 , GLN A:136 , HOH A:2145 , VAL D:98 , ASN D:101 , ILE D:105 , HOH D:2166 , HOH D:2167 , HOH D:2168 , HOH D:2169 , HOH D:2170	BINDING SITE FOR RESIDUE NAG D1205
08	AC8	SOFTWARE	TRP B:81 , VAL B:87 , ASP B:104 , HOH B:2140 , ASN D:132 , HOH D:2134 , HOH D:2171 , HOH D:2173 , HOH D:2174 , HOH D:2175	BINDING SITE FOR RESIDUE NAG D1206
09	AC9	SOFTWARE	ASN A:8 , MET A:10 , ALA A:24 , GLN A:91 , GLY A:114	BINDING SITE FOR RESIDUE PEU A1176
10	BC1	SOFTWARE	ASN C:8 , MET C:10 , LEU C:23 , GLN C:91 , TYR C:111 , GLY C:114	BINDING SITE FOR RESIDUE PEU C1176
11	BC2	SOFTWARE	ARG A:35 , LYS A:44 , LYS C:40	BINDING SITE FOR RESIDUE ACT A1177
12	BC3	SOFTWARE	LYS C:154 , ARG C:158 , HOH D:2113	BINDING SITE FOR RESIDUE ACT C1177
13	BC4	SOFTWARE	MET A:0 , GLU A:1 , HIS A:3 , GLU A:68 , ARG A:75 , ILE A:98 , HIS A:99 , GLU A:100 , SER A:102 , LYS A:152 , THR A:155 , ARG A:158 , ALA A:159 , ASP A:163 , GLN A:169 , HOH A:2076 , HOH A:2158 , HOH A:2160 , VAL B:27 , LEU B:29 , GLY B:30 , SER B:31 , LYS B:32 , SER B:33 , SER B:34 , SER B:36 , THR B:37 , CYS B:38 , ASN B:41 , GLU B:44 , LEU B:45 , ALA B:46 , ILE B:48 , PRO B:50 , GLY B:51 , GLU B:52 , THR B:53 , TRP B:54 , THR B:55 , LEU B:56 , HIS B:57 , GLY B:58 , MET B:59 , CYS B:60 , ILE B:61 , SER B:62 , ILE B:63 , CYS B:64 , TYR B:65 , TYR B:66 , GLU B:67 , NAG B:1203 , NAG B:1204 , NAG B:1205 , NAG B:1206 , HOH B:2007 , HOH B:2013 , HOH B:2032 , HOH B:2041 , HOH B:2043 , HOH B:2057 , HOH B:2058 , HOH B:2066 , HOH B:2067 , HOH B:2068 , HOH B:2069 , HOH B:2070 , HOH B:2071 , HOH B:2072 , HOH B:2073 , HOH B:2074 , HOH B:2075 , HOH B:2076 , HOH B:2077 , HOH B:2078 , HOH B:2079 , HOH B:2080 , HOH B:2081 , HOH B:2082 , HOH B:2083 , HOH B:2084 , HOH B:2085 , HOH B:2088 , HOH B:2089 , HOH B:2090 , HOH B:2091 , HOH B:2092 , HOH B:2093 , HOH B:2094 , HOH B:2096 , HOH B:2097 , HOH B:2098 , HOH B:2099 , HOH B:2101 , HOH B:2102 , HOH B:2103 , HOH B:2104 , HOH B:2105 , HOH B:2106 , HOH B:2107 , HOH B:2108 , HOH B:2109 , HOH B:2110 , HOH B:2111 , HOH B:2112 , HOH B:2113 , HOH B:2116 , HOH B:2117 , HOH B:2119 , HOH B:2120 , HOH B:2121 , HOH B:2124 , HOH B:2125 , HOH B:2126 , HOH B:2129 , HOH B:2131 , HOH B:2133 , HOH B:2134 , HOH B:2135 , HOH B:2136 , HOH B:2137 , HOH B:2138 , HOH B:2140 , HOH B:2141 , HOH B:2142 , HOH B:2143 , HOH B:2144 , HOH B:2145 , HOH B:2146 , HOH B:2147 , HOH B:2148 , HOH B:2149 , HOH B:2150 , HOH B:2152 , HOH B:2153 , HOH B:2154 , HOH B:2155 , HOH B:2157 , HOH B:2158 , HOH B:2159 , HOH B:2160 , HOH B:2168 , HOH B:2169 , HOH B:2170 , ALA C:56 , ASP C:60 , TRP D:81 , HIS D:83 , ASN D:132 , LEU D:133 , ASN D:145 , THR D:147 , NAG D:1202 , NAG D:1203 , NAG D:1206 , HOH D:2078 , HOH D:2162	BINDING SITE FOR CHAIN B OF SUGAR BOUND TO ASN B 68 RESIDUES 68 TO 1202
14	BC5	SOFTWARE	ALA A:56 , ASP A:60 , GLN A:131 , SER A:132 , SER A:133 , ARG A:134 , HOH A:2118 , GLU B:67 , TRP B:81 , HIS B:83 , ASN B:132 , LEU B:133 , ASN B:145 , THR B:147 , LYS B:149 , NAG B:1202 , NAG B:1203 , NAG B:1206 , HOH B:2065 , HOH B:2083 , GLU C:68 , ARG C:75 , LYS C:152 , THR C:155 , HIS C:156 , ARG C:158 , ALA C:159 , ASP C:163 , HOH C:2110 , VAL D:27 , ASP D:28 , LEU D:29 , GLY D:30 , SER D:31 , LYS D:32 , SER D:33 , SER D:34 , SER D:36 , THR D:37 , CYS D:38 , ASN D:41 , GLU D:44 , LEU D:45 , ALA D:46 , ILE D:48 , PRO D:50 , GLY D:51 , GLU D:52 , THR D:53 , TRP D:54 , THR D:55 , LEU D:56 , HIS D:57 , GLY D:58 , MET D:59 , CYS D:60 , ILE D:61 , SER D:62 , ILE D:63 , CYS D:64 , TYR D:65 , TYR D:66 , GLU D:67 , NAG D:1203 , NAG D:1204 , NAG D:1205 , NAG D:1206 , HOH D:2027 , HOH D:2039 , HOH D:2048 , HOH D:2057 , HOH D:2058 , HOH D:2059 , HOH D:2060 , HOH D:2061 , HOH D:2062 , HOH D:2063 , HOH D:2064 , HOH D:2065 , HOH D:2066 , HOH D:2067 , HOH D:2068 , HOH D:2069 , HOH D:2070 , HOH D:2071 , HOH D:2072 , HOH D:2073 , HOH D:2074 , HOH D:2075 , HOH D:2077 , HOH D:2078 , HOH D:2079 , HOH D:2082 , HOH D:2083 , HOH D:2084 , HOH D:2085 , HOH D:2086 , HOH D:2089 , HOH D:2091 , HOH D:2092 , HOH D:2093 , HOH D:2094 , HOH D:2095 , HOH D:2096 , HOH D:2097 , HOH D:2098 , HOH D:2099 , HOH D:2100 , HOH D:2101 , HOH D:2102 , HOH D:2103 , HOH D:2104 , HOH D:2105 , HOH D:2106 , HOH D:2107 , HOH D:2108 , HOH D:2110 , HOH D:2111 , HOH D:2112 , HOH D:2113 , HOH D:2116 , HOH D:2117 , HOH D:2118 , HOH D:2120 , HOH D:2122 , HOH D:2123 , HOH D:2124 , HOH D:2125 , HOH D:2126 , HOH D:2127 , HOH D:2128 , HOH D:2129 , HOH D:2130 , HOH D:2131 , HOH D:2132 , HOH D:2133 , HOH D:2134 , HOH D:2136 , HOH D:2137 , HOH D:2138 , HOH D:2139 , HOH D:2140 , HOH D:2141 , HOH D:2142 , HOH D:2143 , HOH D:2144 , HOH D:2145 , HOH D:2146 , HOH D:2148 , HOH D:2149 , HOH D:2150 , HOH D:2151 , HOH D:2153 , HOH D:2154 , HOH D:2156 , HOH D:2158 , HOH D:2166 , HOH D:2171 , HOH D:2176 , HOH D:2177	BINDING SITE FOR CHAIN D OF SUGAR BOUND TO ASN D 68 RESIDUES 68 TO 1202

SS Bonds (6, 6)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (9, 17)

Asymmetric Unit (9, 17)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_044068	E	39	G	MICB_HUMAN	Polymorphism	45578846	A/C	E	16	G
2	UniProt	VAR_044069	P	68	H	MICB_HUMAN	Polymorphism	45583740	A/C	P	45	H
3	UniProt	VAR_044070	D	75	N	MICB_HUMAN	Polymorphism	3131639	A/C	D	52	N
4	UniProt	VAR_044071	K	80	E	MICB_HUMAN	Polymorphism	1065075	A/C	E	57	E
5	UniProt	VAR_044072	D	88	G	MICB_HUMAN	Polymorphism	45486091	A/C	D	65	G
6	UniProt	VAR_044073	D	105	G	MICB_HUMAN	Polymorphism	45502297	A	D	82	G
7	UniProt	VAR_044074	I	121	M	MICB_HUMAN	Polymorphism	3134900	A/C	I	98	M
8	UniProt	VAR_059527	D	136	H	MICB_HUMAN	Polymorphism	1051788	A/C	N	113	H
9	UniProt	VAR_044075	D	136	N	MICB_HUMAN	Polymorphism	1051788	A/C	N	113	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (9, 9)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_044068	E	39	G	MICB_HUMAN	Polymorphism	45578846	A	E	16	G
2	UniProt	VAR_044069	P	68	H	MICB_HUMAN	Polymorphism	45583740	A	P	45	H
3	UniProt	VAR_044070	D	75	N	MICB_HUMAN	Polymorphism	3131639	A	D	52	N
4	UniProt	VAR_044071	K	80	E	MICB_HUMAN	Polymorphism	1065075	A	E	57	E
5	UniProt	VAR_044072	D	88	G	MICB_HUMAN	Polymorphism	45486091	A	D	65	G
6	UniProt	VAR_044073	D	105	G	MICB_HUMAN	Polymorphism	45502297	A	D	82	G
7	UniProt	VAR_044074	I	121	M	MICB_HUMAN	Polymorphism	3134900	A	I	98	M
8	UniProt	VAR_059527	D	136	H	MICB_HUMAN	Polymorphism	1051788	A	N	113	H
9	UniProt	VAR_044075	D	136	N	MICB_HUMAN	Polymorphism	1051788	A	N	113	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (8, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_044068	E	39	G	MICB_HUMAN	Polymorphism	45578846	C	E	16	G
2	UniProt	VAR_044069	P	68	H	MICB_HUMAN	Polymorphism	45583740	C	P	45	H
3	UniProt	VAR_044070	D	75	N	MICB_HUMAN	Polymorphism	3131639	C	D	52	N
4	UniProt	VAR_044071	K	80	E	MICB_HUMAN	Polymorphism	1065075	C	E	57	E
5	UniProt	VAR_044072	D	88	G	MICB_HUMAN	Polymorphism	45486091	C	D	65	G
7	UniProt	VAR_044074	I	121	M	MICB_HUMAN	Polymorphism	3134900	C	I	98	M
8	UniProt	VAR_059527	D	136	H	MICB_HUMAN	Polymorphism	1051788	C	N	113	H
9	UniProt	VAR_044075	D	136	N	MICB_HUMAN	Polymorphism	1051788	C	N	113	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:173
 aligned with MICB_HUMAN | Q29980 from UniProtKB/Swiss-Prot  Length:383

    Alignment length:176
                                    32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192      
           MICB_HUMAN    23 AEPHSLRYNLMVLSQDESVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTRGSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSG 198
               SCOP domains d2wy3a_ A: automated matches                                                                                                                                                     SCOP domains
               CATH domains 2wy3A00 A:0-175 Murine Class I Major Histocompatibility Complex, H2-DB, subunit A, domain 1                                                                                      CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeeeee..ee....eeeeee..eeeeeee....eeee.hhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh.......eeeeeeeeeeee.....eeeeeeeee..eeeeeee.....ee...hhhhhhhhhhhhhhhhh---hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ----------------G----------------------------H------N----E-------G----------------G---------------M--------------H-------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------N-------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wy3 A   0 MEPHSLRYNLMVLSQDESVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTRGSRHFYYNGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKE---KTKTHYRAMQADCLQKLQRYLKSG 175
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139        |-  |    159       169      
                                                                                                                                                                              148 152

Chain B from PDB  Type:PROTEIN  Length:137
 aligned with UL16P_HCMVA | P16757 from UniProtKB/Swiss-Prot  Length:230

    Alignment length:137
                                    36        46        56        66        76        86        96       106       116       126       136       146       156       
          UL16P_HCMVA    27 VDLGSKSSNSTCRLNVTELASIHPGETWTLHGMCISICYYENVTEDEIIGVAFTWQHNESVVDLWLYQNDTVIRNFSDITTNILQDGLKMRTVPVTKLYTSRMVTNLTVGRYDCLRCENGTTKIIERLYVRLGSLYP 163
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee....eeee.hhhhhhhh....eeeee..eeeeeeee.......eeeeeee......eeeeeee..eeee.......eeeeeeee.....eeeeeeee.......eeeeeeeee..eeeeeeeeeee...... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wy3 B  27 VDLGSKSSNSTCRLNVTELASIHPGETWTLHGMCISICYYENVTEDEIIGVAFTWQHNESVVDLWLYQNDTVIRNFSDITTNILQDGLKMRTVPVTKLYTSRMVTNLTVGRYDCLRCENGTTKIIERLYVRLGSLYP 163
                                    36        46        56        66        76        86        96       106       116       126       136       146       156

Chain C from PDB  Type:PROTEIN  Length:167
 aligned with MICB_HUMAN | Q29980 from UniProtKB/Swiss-Prot  Length:383

    Alignment length:175
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193     
           MICB_HUMAN    24 EPHSLRYNLMVLSQDESVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTRGSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSG 198
               SCOP domains d2wy3c_ C: automated matches                                                                                                                                                    SCOP domains
               CATH domains 2wy3C00 C:1-175 Murine Class I Major Histocompatibility Complex, H2-DB, subunit       A, domain 1                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeee..ee....eeeeee..eeeeeee....eeee.hhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh.------.eeeeeeeeeee.....eeeeeeeee..eeeeeee.....ee...hhhhhhhhhhhhhhh.--..hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
             SAPs(SNPs) (1) ---------------G----------------------------H------N----E-------G--------------------------------M--------------H-------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------------------------------------------------------------N-------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wy3 C   1 EPHSLRYNLMVLSQDESVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQWAEDVLGAETWDTETEDLTENGQDLRRTLTHI------LHSLQEIRVCEIHEDSSTRGSRHFYYNGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWK--AMKTKTHYRAMQADCLQKLQRYLKSG 175
                                    10        20        30        40        50        60        70        80      | 90       100       110       120       130       140      |150       160       170     
                                                                                                          80     87                                                         147  |                         
                                                                                                                                                                               150

Chain D from PDB  Type:PROTEIN  Length:133
 aligned with UL16P_HCMVA | P16757 from UniProtKB/Swiss-Prot  Length:230

    Alignment length:133
                                    36        46        56        66        76        86        96       106       116       126       136       146       156   
          UL16P_HCMVA    27 VDLGSKSSNSTCRLNVTELASIHPGETWTLHGMCISICYYENVTEDEIIGVAFTWQHNESVVDLWLYQNDTVIRNFSDITTNILQDGLKMRTVPVTKLYTSRMVTNLTVGRYDCLRCENGTTKIIERLYVRLG 159
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee....eeee.hhhhhhhh....eeeee...eeeeeee.......eeeeeee......eeeeeee..eeee.......eeeeeeee.....eeeeeeee.......eeeeeeeee..eeeeeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wy3 D  27 VDLGSKSSNSTCRLNVTELASIHPGETWTLHGMCISICYYENVTEDEIIGVAFTWQHNESVVDLWLYQNDTVIRNFSDITTNILQDGLKMRTVPVTKLYTSRMVTNLTVGRYDCLRCENGTTKIIERLYVRLG 159
                                    36        46        56        66        76        86        96       106       116       126       136       146       156

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (24, 27)

Asymmetric Unit(hide GO term definitions)

Chain A,C (MICB_HUMAN | Q29980)

molecular function
	GO:0003823	antigen binding	Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.
	GO:0046703	natural killer cell lectin-like receptor binding	Interacting selectively and non-covalently with a lectin-like natural killer cell receptor.
biological process
	GO:0001913	T cell mediated cytotoxicity	The directed killing of a target cell by a T cell through the release of granules containing cytotoxic mediators or through the engagement of death receptors.
	GO:0002250	adaptive immune response	An immune response mediated by cells expressing specific receptors for antigen produced through a somatic diversification process, and allowing for an enhanced secondary response to subsequent exposures to the same antigen (immunological memory).
	GO:0019882	antigen processing and presentation	The process in which an antigen-presenting cell expresses antigen (peptide or lipid) on its cell surface in association with an MHC protein complex.
	GO:0019835	cytolysis	The rupture of cell membranes and the loss of cytoplasm.
	GO:0046629	gamma-delta T cell activation	The change in morphology and behavior of a gamma-delta T cell resulting from exposure to a mitogen, cytokine, chemokine, cellular ligand, or an antigen for which it is specific.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002429	immune response-activating cell surface receptor signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of a cell capable of activating or perpetuating an immune response.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0042267	natural killer cell mediated cytotoxicity	The directed killing of a target cell by a natural killer cell through the release of granules containing cytotoxic mediators or through the engagement of death receptors.
	GO:0050689	negative regulation of defense response to virus by host	Any host process that results in the inhibition of antiviral immune response mechanisms, thereby facilitating viral replication. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0050776	regulation of immune response	Any process that modulates the frequency, rate or extent of the immune response, the immunological reaction of an organism to an immunogenic stimulus.
	GO:0009408	response to heat	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a heat stimulus, a temperature stimulus above the optimal temperature for that organism.
	GO:0006979	response to oxidative stress	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.
	GO:0032526	response to retinoic acid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a retinoic acid stimulus.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain B,D (UL16P_HCMVA | P16757)

biological process
	GO:0039671	evasion by virus of host natural killer cell activity	Any process by which a virus avoids the effects mediated by the host organism's natural killer (NK) cells.
	GO:0030683	evasion or tolerance by virus of host immune response	Any process, either active or passive, by which a virus avoids the effects of the host organism's immune response. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0033644	host cell membrane	Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ACT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PEU	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2wy3)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 18)

Sites (14, 14)

SS Bonds (6, 6)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (9, 17)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (24, 27)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File