Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF N-MYRISTOYLTRANSFERASE FROM L. DONOVANI
 
Authors :  J. A. Brannigan, B. A. Smith, Z. Yu, M. R. Hodgkinson, R. J. Leatherbarrow, E. W. Tate, A. M. Brzozowski, D. F. Smith, A. J. Wilkinson
Date :  09 Oct 09  (Deposition) - 01 Dec 09  (Release) - 18 Jul 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.42
Chains :  Asym./Biol. Unit :  A
Keywords :  Transferase, Acyltransferase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. A. Brannigan, B. A. Smith, Z. Yu, A. M. Brzozowski, M. R. Hodgkinson, A. Maroof, H. P. Price, F. Meier, R. J. Leatherbarrow, E. W. Tate, D. F. Smith, A. J. Wilkinson
N-Myristoyltransferase From Leishmania Donovani: Structural And Functional Characterisation Of A Potential Drug Target For Visceral Leishmaniasis.
J. Mol. Biol. V. 396 985 2010
PubMed-ID: 20036251  |  Reference-DOI: 10.1016/J.JMB.2009.12.032

(-) Compounds

Molecule 1 - N-MYRISTOYLTRANSFERASE
    ChainsA
    EC Number2.3.1.97
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28-BASED
    Expression System StrainBL21(DE3)PRARES
    Expression System Taxid469008
    Organism ScientificLEISHMANIA DONOVANI
    Organism Taxid5661
    StrainLV9
    VariantMHOM/ET/67/L28

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1NHW1Ligand/Ion2-OXOPENTADECYL-COA

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:12 , ALA A:13 , PHE A:14 , TRP A:15 , ASN A:79 , TYR A:80 , VAL A:81 , ASN A:167 , PHE A:168 , LEU A:169 , CYS A:170 , VAL A:171 , ARG A:176 , GLU A:177 , LYS A:178 , ARG A:179 , LEU A:180 , ALA A:181 , PRO A:182 , THR A:189 , VAL A:192 , TRP A:198 , ALA A:200 , TYR A:202 , THR A:203 , LEU A:208 , TYR A:404 , HOH A:2164 , HOH A:2165 , HOH A:2373 , HOH A:2374 , HOH A:2375 , HOH A:2376 , HOH A:2377 , HOH A:2378BINDING SITE FOR RESIDUE NHW A1422

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2WUU)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Pro A:209 -Thr A:210

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2WUU)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2WUU)

(-) Exons   (0, 0)

(no "Exon" information available for 2WUU)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:402
 aligned with A4I7H1_LEIIN | A4I7H1 from UniProtKB/TrEMBL  Length:421

    Alignment length:411
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420 
         A4I7H1_LEIIN    11 AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPSYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGQEEEAAKYDAPRHICEINFLCVHKQLREKRLAPILIKEVTRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPNAPKNSGLREMKPSDVPQVRRILMNYLDNFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNILNAAYVHYYAATSMPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML 421
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------NMT-2wuuA01 A:33-215                                                                                                                                                                   -------------NMT_C-2wuuA02 A:229-420                                                                                                                                                                         - Pfam domains
         Sec.struct. author ...hhhhh....hhhhhhh...........hhhhh..........eeee.....hhhhhhhhhhhhhhhh..---..eee..hhhhhhhhhh....hhhhheeeee.....eeeeeeeeeeee....hhhhhhhhhhh.hhhhhhh....eeeeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh....eeeee..................hhhhhhhh.....hhhhh...hhhhhhhhhhh..........ee.hhhhhhhhhhhhhhhhh........hhhhhhhhhh.....eeeeeeee..eeeeeeeeeeeeeee.------...............hhhhhhhhhhhhhhhh...........hhhhhh............eeeee.......hhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wuu A  11 AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVE---SMFRFNYSEEFLQWALCPPSYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGQEEEAAKYDAPRHICEINFLCVHKQLREKRLAPILIKEVTRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPNAPKNSGLREMKPSDVPQVRRILMNYLDNFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVI------ILNAAYVHYYAATSMPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML 421
                                    20        30        40        50        60        70        80 |   |  90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330  |    340       350       360       370       380       390       400       410       420 
                                                                                                  82  86                                                                                                                                                                                                                                                    333    340                                                                                 

Chain A from PDB  Type:PROTEIN  Length:402
 aligned with D0AB09_LEIDO | D0AB09 from UniProtKB/TrEMBL  Length:421

    Alignment length:411
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420 
         D0AB09_LEIDO    11 AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPSYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGQEEEAAKYDAPRHICEINFLCVHKQLREKRLAPILIKEVTRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPNAPKNSGLREMKPSDVPQVRRILMNYLDNFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNILNAAYVHYYAATSMPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML 421
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------NMT-2wuuA01 A:33-215                                                                                                                                                                   -------------NMT_C-2wuuA02 A:229-420                                                                                                                                                                         - Pfam domains
         Sec.struct. author ...hhhhh....hhhhhhh...........hhhhh..........eeee.....hhhhhhhhhhhhhhhh..---..eee..hhhhhhhhhh....hhhhheeeee.....eeeeeeeeeeee....hhhhhhhhhhh.hhhhhhh....eeeeeeeeeee.hhhh..hhhhhhhhhhhhhhhhh....eeeee..................hhhhhhhh.....hhhhh...hhhhhhhhhhh..........ee.hhhhhhhhhhhhhhhhh........hhhhhhhhhh.....eeeeeeee..eeeeeeeeeeeeeee.------...............hhhhhhhhhhhhhhhh...........hhhhhh............eeeee.......hhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wuu A  11 AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVE---SMFRFNYSEEFLQWALCPPSYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGQEEEAAKYDAPRHICEINFLCVHKQLREKRLAPILIKEVTRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPNAPKNSGLREMKPSDVPQVRRILMNYLDNFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVI------ILNAAYVHYYAATSMPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML 421
                                    20        30        40        50        60        70        80 |   |  90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330  |    340       350       360       370       380       390       400       410       420 
                                                                                                  82  86                                                                                                                                                                                                                                                    333    340                                                                                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2WUU)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2WUU)

(-) Pfam Domains  (2, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (4, 8)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (A4I7H1_LEIIN | A4I7H1)
molecular function
    GO:0004379    glycylpeptide N-tetradecanoyltransferase activity    Catalysis of the reaction: tetradecanoyl-CoA + glycyl-peptide = CoA + N-tetradecanoylglycyl-peptide.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
    GO:0006499    N-terminal protein myristoylation    The covalent attachment of a myristoyl group to the N-terminal amino acid residue of a protein.

Chain A   (D0AB09_LEIDO | D0AB09)
molecular function
    GO:0004379    glycylpeptide N-tetradecanoyltransferase activity    Catalysis of the reaction: tetradecanoyl-CoA + glycyl-peptide = CoA + N-tetradecanoylglycyl-peptide.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
    GO:0006499    N-terminal protein myristoylation    The covalent attachment of a myristoyl group to the N-terminal amino acid residue of a protein.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NHW  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Pro A:209 - Thr A:210   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2wuu
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A4I7H1_LEIIN | A4I7H1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  D0AB09_LEIDO | D0AB09
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.97
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A4I7H1_LEIIN | A4I7H1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  D0AB09_LEIDO | D0AB09
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2WUU)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2WUU)