Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE PEROXISOMAL 3-KETOACYL-COA THIOLASE FROM SUNFLOWER
 
Authors :  V. E. Pye, C. E. Christensen, J. H. Dyer, S. Arent, A. Henriksen
Date :  01 Oct 09  (Deposition) - 12 May 10  (Release) - 04 Aug 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.80
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Transferase, Beta Oxidation, Plant Lipid Metabolism, Acyltransferase, Cysteine Oxidation (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  V. E. Pye, C. E. Christensen, J. H. Dyer, S. Arent, A. Henriksen
Peroxisomal Plant 3-Ketoacyl-Coa Thiolases Structure And Activity Are Regulated By A Sensitive Redox Switch
J. Biol. Chem. V. 285 24078 2010
PubMed-ID: 20463027  |  Reference-DOI: 10.1074/JBC.M110.106013

(-) Compounds

Molecule 1 - ACETOACETYL COA THIOLASE
    Chains: A, B
    EC Number: 2.3.1.16
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector: PET24B
    Fragment: RESIDUES 17-449
    Mutation: YES
    Organism Common: COMMON SUNFLOWER
    Organism Scientific: HELIANTHUS ANNUUS
    Organism Taxid: 4232
    Synonym: 3-KETOACYL-COA THIOLASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2WUA)

(-) Sites  (0, 0)

(no "Site" information available for 2WUA)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2WUA)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2WUA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2WUA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2WUA)

(-) Exons   (0, 0)

(no "Exon" information available for 2WUA)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:392
 aligned with Q6W6X6_HELAN | Q6W6X6 from UniProtKB/TrEMBL  Length:449

    Alignment length:392
                                    56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436  
         Q6W6X6_HELAN    47 GDDVVIVAAYRSPLCKAKRGGLKDTYPDDILAPVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNPKVKTMAQAQDCLLPMGITSENVAQKFSITRQEQDQAAVGSHRKAAAATAAGRFKDEIIPIKTKIVDPKTGDEKPVTISVDDGIRPGTSLADLAKLKPVFRKDGSTTAGTSSQVSDGAGAVLLMKRSIALQKGLPILGVFRTFAAVGVPPSIMGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQFVYCQKKLEIDPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGD 438
               SCOP domains d2wuaa1 A:47-309 automated matches                                                                                                                                                                                                                                     d2wuaa2 A:310-438 automated matches                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee.....ee.........hhhhhhhhhhhhhhhhhh.hhhhh..eee.......hhhhhhhhhhhhhh.......eeeeehhhhh.hhhhhhhhhhhhh.........................hhhhhhhhhhhhh.....hhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhh.........eeeeee......eeeeee..........hhhhhhh...................ee....eeeeehhhhhhh.......eeeee....hhhhh.....hhhhhhhhhh..hhhhh...ee...hhhhhhhhhhhhh.hhhh..................hhhhhhhhhhhhhh........ee.........eeee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wua A  47 GDDVVIVAAYRSPLCKAKRGGLKDTYPDDILAPVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNPKVKTMAQAQDCLLPMGITSENVAQKFSITRQEQDQAAVGSHRKTAAATAAGRFKDEIIPIKTKIVDPKTGDEKPVTISVDDGIRPGTSLADLAKLKPVFRKDGSTTAGTSSQVSDGAGAVLLMKRSIALQKGLPILGVFRTFAAVGVPPSIMGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQFVYCQKKLEIDPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGD 438
                                    56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436  


Chain B from PDB  Type:PROTEIN  Length:394
 aligned with Q6W6X6_HELAN | Q6W6X6 from UniProtKB/TrEMBL  Length:449

    Alignment length:394
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434    
         Q6W6X6_HELAN    45 VFGDDVVIVAAYRSPLCKAKRGGLKDTYPDDILAPVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNPKVKTMAQAQDCLLPMGITSENVAQKFSITRQEQDQAAVGSHRKAAAATAAGRFKDEIIPIKTKIVDPKTGDEKPVTISVDDGIRPGTSLADLAKLKPVFRKDGSTTAGTSSQVSDGAGAVLLMKRSIALQKGLPILGVFRTFAAVGVPPSIMGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQFVYCQKKLEIDPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGD 438
               SCOP domains d2wuab1 B:45-309 automated matches                                                                                                                                                                                                                                       d2wuab2 B:310-438 automated matches                                                                                               SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --Thiolase_N-2wuaB03 B:47-305                                                                                                                                                                                                                                        ------Thiolase_C-2wuaB01 B:312-436                                                                                                 -- Pfam domains (1)
           Pfam domains (2) --Thiolase_N-2wuaB04 B:47-305                                                                                                                                                                                                                                        ------Thiolase_C-2wuaB02 B:312-436                                                                                                 -- Pfam domains (2)
         Sec.struct. author .....eeeeee.....ee.........hhhhhhhhhhhhhhhhhh.hhhhh..eee.......hhhhhhhhhhhhhh.......eeeeehhhhh.hhhhhhhhhhhhh...........................hhhhhhhhhhh.....hhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhh.........eeeeee......eeeeee..........hhhhhhh...................ee....eeeeehhhhhhh.......eeeee....hhhhh.....hhhhhhhhhh..hhhhh...ee...hhhhhhhhhhhhh.hhhh..................hhhhhhhhhhhhhh........ee.........eeee.... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wua B  45 VFGDDVVIVAAYRSPLCKAKRGGLKDTYPDDILAPVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNPKVKTMAQAQDCLLPMGITSENVAQKFSITRQEQDQAAVGSHRKTAAATAAGRFKDEIIPIKTKIVDPKTGDEKPVTISVDDGIRPGTSLADLAKLKPVFRKDGSTTAGTSSQVSDGAGAVLLMKRSIALQKGLPILGVFRTFAAVGVPPSIMGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQFVYCQKKLEIDPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAAVFERGD 438
                                    54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2WUA)

(-) Pfam Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Clan: Thiolase (72)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q6W6X6_HELAN | Q6W6X6)
molecular function
    GO:0003988    acetyl-CoA C-acyltransferase activity    Catalysis of the reaction: acyl-CoA + acetyl-CoA = CoA + 3-oxoacyl-CoA.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
    GO:0016747    transferase activity, transferring acyl groups other than amino-acyl groups    Catalysis of the transfer of an acyl group, other than amino-acyl, from one compound (donor) to another (acceptor).
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2wua)
 
  Sites
(no "Sites" information available for 2wua)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2wua)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2wua
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q6W6X6_HELAN | Q6W6X6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.16
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q6W6X6_HELAN | Q6W6X6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2WUA)

(-) Related Entries Specified in the PDB File

2wu9 CRYSTAL STRUCTURE OF PEROXISOMAL KAT2 FROM ARABIDOPSIS THALIANA