Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  EQUINE RHINITIS A VIRUS AT LOW PH
 
Authors :  E. E. Fry, T. J. Tuthill, K. Harlos, T. S. Walter, N. J. Knowles, E. Gropel D. J. Rowlands, D. I. Stuart
Date :  04 Sep 09  (Deposition) - 25 Aug 10  (Release) - 25 Aug 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym. Unit :  1,2,3,4
Biol. Unit 1:  1,2,3,4  (60x)
Keywords :  Virus, Capsid, Picornavirus (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  T. J. Tuthill, K. Harlos, T. S. Walter, N. J. Knowles, E. Groppelli, D. J. Rowlands, D. I. Stuart, E. E. Fry
Equine Rhinitis A Virus And Its Low Ph Empty Particle: Clues Towards An Aphthovirus Entry Mechanism?
Plos Pathog. V. 5 620 2009
PubMed-ID: 19816570  |  Reference-DOI: 10.1371/JOURNAL.PPAT.1000620

(-) Compounds

Molecule 1 - P1
    Chains: 1
    Fragment: CAPSID PROTEIN VP1, RESIDUES 537-782
    Organism Scientific: EQUINE RHINITIS A VIRUS
    Organism Taxid: 47000
    Strain: NM11/67
 
Molecule 2 - P1
    Chains: 2
    Fragment: CAPSID PROTEIN VP2, RESIDUES 81-310
    Organism Scientific: EQUINE RHINITIS A VIRUS
    Organism Taxid: 47000
    Strain: NM11/67
 
Molecule 3 - P1
    Chains: 3
    Fragment: CAPSID PROTEIN VP3, RESIDUES 311-536
    Organism Scientific: EQUINE RHINITIS A VIRUS
    Organism Taxid: 47000
    Strain: NM11/67
 
Molecule 4 - P1
    Chains: 4
    Fragment: CAPSID PROTEIN VP4, RESIDUES 1-80
    Organism Scientific: EQUINE RHINITIS A VIRUS
    Organism Taxid: 47000
    Strain: NM11/67

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : 1234
Biological Unit 1 (60x): 1234

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2WS9)

(-) Sites  (0, 0)

(no "Site" information available for 2WS9)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2WS9)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Leu 2:83 -Pro 2:84

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2WS9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2WS9)

(-) Exons   (0, 0)

(no "Exon" information available for 2WS9)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain 1 from PDB  Type:PROTEIN  Length:246
 aligned with B9VV85_9PICO | B9VV85 from UniProtKB/TrEMBL  Length:784

    Alignment length:246
                                   546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776      
         B9VV85_9PICO   537 VTNVGEDGEPGETEPRHALSPVDMHVHTDVSFLLDRFFDVETLELSNLTGSPATHVLDPFGSTAQLAWARLLNTCTYFFSDLELSIQFKFTTTPSSVGEGFVWVKWFPVGAPTKTTDAWQLEGGGNSVRIQQLAVAGMSPTVVFKIAGSRSQACGFSVPYTSMWRVVPVFYNGWGAPTKEKATYNWLPGAHFGSILLTSDAHDKGGCYLRYRFPRANMYCPRPIPPAFTRPADKTRHKFPTNINKQ 782
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ........................hhhhhhhhhhh..ee...............ee...........hhhhhh...eee..eeeee..ee..hhhhh...eeeeeee.........eeeeee....eeeee.........eeeee........eeeee........ee.........................eeeeee.....ee..eeee....eee........................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2ws9 1   1 VTNVGEDGEPGETEPRHALSPVDMHVHTDVSFLLDRFFDVETLELSNLTGSPATHVLDPFGSTAQLAWARLLNTCTYFFSDLELSIQFKFTTTPSSVGEGFVWVKWFPVGAPTKTTDAWQLEGGGNSVRIQQLAVAGMSPTVVFKIAGSRSQACGFSVPYTSMWRVVPVFYNGWGAPTKEKATYNWLPGAHFGSILLTSDAHDKGGCYLRYRFPRANMYCPRPIPPAFTRPADKTRHKFPTNINKQ 246
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240      


Chain 2 from PDB  Type:PROTEIN  Length:200
 aligned with B9VV85_9PICO | B9VV85 from UniProtKB/TrEMBL  Length:784

    Alignment length:200
                                   120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310
         B9VV85_9PICO   111 GTTYCYSKPDGRPPSTVSDPVTRLGPTLSRHYTFKVGEWPHSQSHGHAWICPLPGDKLKKMGSFHEVVKAHHLVKNGWDVVVQVNASFAHSGALCVAAVPEYEHTHEKALKWSELEEPAYTYQQLSVFPHQLLNLRTNSSVHLVMPYIGPGPTTNLTLHNPWTIVILILSELTGPGQTVPVTMSVAPIDAMVNGPLPNPE 310
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee................eee........eeeeeeee.......eeeeee....hhhhhhhhhhhhhheeeeeeeeeeeeee......eeeeeeeeee............eeee..hhhhhhhhhh.eeeee.....eeeeee................eeeeeeeeeeee.....eeeeeeeeeeeeeeeee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ws9 2  31 GTTYCYSKPDGRPPSTVSDPVTRLGPTLSRHYTFKVGEWPHSQSHGHAWICPLPSDKLKKMGSFHEVVKAHHLVKNGWDVVVQVNASFAHSGALCVAAVPEYEHTHEKALKWSELEEPAYTYQQLSVFPHQLLNLRTNSSVHLVMPYIGPGPTTNLTLHNPWTIVILILSELTGPGQTVPVTMSVAPIDAMVNGPLPNPE 230
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230


Chain 3 from PDB  Type:PROTEIN  Length:226
 aligned with B9VV85_9PICO | B9VV85 from UniProtKB/TrEMBL  Length:784

    Alignment length:226
                                   320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530      
         B9VV85_9PICO   311 APIRVVSVPESDSFMSSVPDNSTPLYPKVVVPPRQVPGRFTNFIDVAKQTYSFCSISGRPYFEVTNTSGDEPLFQMDVSLSAAELHGTYVASLSSFFAQYRGSLNFNFIFTGAAATKAKFLVAFVPPHSAAPKTRDEAMACIHAVWDVGLNSAFSFNVPYSSPADFMAVYSAEATVVNVSGWLQVYALTALTSTDIAVNSKGRVLVAVSAGPDFSLRHPVDLPDKQ 536
               SCOP domains d2ws93_ 3: automated matches                                                                                                                                                                                                       SCOP domains
               CATH domains 2ws9300 3:1-226  [code=2.60.120.20, no name defined]                                                                                                                                                                               CATH domains
           Pfam domains (1) -----------------------------Rhv-2ws9301 3:30-187                                                                                                                                          --------------------------------------- Pfam domains (1)
           Pfam domains (2) -----------------------------Rhv-2ws9302 3:30-187                                                                                                                                          --------------------------------------- Pfam domains (2)
         Sec.struct. author .............................ee.......ee.hhhhhhhh..ee.......eeeee......eeeeee..........hhhhhhhh.eeeee..eeeeeee.....eeeeeeeeee........hhhhhh..eeeeee.....eeeeee........ee.............eeeeeeeeeeee.......eeeeeeeeee....eeeee....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ws9 3   1 APIRVVSVPESDSFMSSVPDNSTPLYPKVVVPPRQVPGRFTNFIDVAKQTYSFCSISGKPYFEVTNTSGDEPLFQMDVSLSAAELHGTYVASLSSFFAQYRGSLNFNFIFTGAAATKAKFLVAFVPPHSAAPKTRDEAMACIHAVWDVGLNSAFSFNVPYSSPADFMAVYSAEATVVNVSGWLQVYALTALTSTDIAVNSKGRVLVAVSAGPDFSLRHPVDLPDKQ 226
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220      


Chain 4 from PDB  Type:PROTEIN  Length:21
 aligned with B9VV85_9PICO | B9VV85 from UniProtKB/TrEMBL  Length:784

    Alignment length:21
                                    25        35 
         B9VV85_9PICO    16 GNSGSIVQNFYMQQYQNSIDA  36
               SCOP domains --------------------- SCOP domains
               CATH domains --------------------- CATH domains
               Pfam domains VP4_2-2ws9401 4:16-36 Pfam domains
         Sec.struct. author ....hhhhhh.hhhhhh.ee. Sec.struct. author
                 SAPs(SNPs) --------------------- SAPs(SNPs)
                    PROSITE --------------------- PROSITE
                 Transcript --------------------- Transcript
                 2ws9 4  16 GNSGSIVQNFYMQQYQNSIDA  36
                                    25        35
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (2, 3)

Asymmetric Unit
(-)
Clan: Viral_ssRNA_CP (106)
(-)
Family: Rhv (55)
(-)
Clan: no clan defined [family: VP4_2] (10)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain 1,2,3,4   (B9VV85_9PICO | B9VV85)
molecular function
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
cellular component
    GO:0019030    icosahedral viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles; the subunits are arranged to form an icosahedron, a solid with 20 faces and 12 vertices. Icosahedral capsids have 12 pentamers plus 10(T-1) hexamers, where T is the triangulation number. Tobacco satellite necrosis virus has such a capsid structure.
    GO:0019028    viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ws9)
 
  Sites
(no "Sites" information available for 2ws9)
 
  Cis Peptide Bonds
    Leu 2:83 - Pro 2:84   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ws9
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B9VV85_9PICO | B9VV85
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B9VV85_9PICO | B9VV85
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        B9VV85_9PICO | B9VV85: 2wff 2xbo 4ctg

(-) Related Entries Specified in the PDB File

2wff EQUINE RHINITIS A VIRUS