Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE NITROREDUCTASE CIND FROM LACTOCOCCUS LACTIS IN COMPLEX WITH FMN
 
Authors :  S. M. Waltersperger, A. E. Oberholzer, M. Solioz, U. Baumann
Date :  20 Aug 09  (Deposition) - 30 Jun 10  (Release) - 11 Aug 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.35
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Nitroreductase, Copr Regulated Protein, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Mermod, F. Mourlane, S. Waltersperger, A. E. Oberholzer, U. Baumann, M. Solioz
Structure And Function Of Cind (Ytjd) Of Lactococcus Lactis, A Copper-Induced Nitroreductase Involved In Defense Against Oxidative Stress.
J. Bacteriol. V. 192 4172 2010
PubMed-ID: 20562311  |  Reference-DOI: 10.1128/JB.00372-10

(-) Compounds

Molecule 1 - COPPER INDUCED NITROREDUCTASE D
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PPROEX HTA
    Expression System Strain: DH5 ALPHA
    Expression System Taxid: 562
    Organism Scientific: LACTOCOCCUS LACTIS
    Organism Taxid: 1358
    Strain: IL1403
    Synonym: PUTATIVE UNCHARACTERIZED PROTEIN YTJD

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric Unit (1, 1)
No.NameCountTypeFull Name
1FMN1Ligand/IonFLAVIN MONONUCLEOTIDE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:10 , ARG A:11 , THR A:12 , TYR A:14 , PRO A:38 , THR A:39 , ALA A:40 , PHE A:41 , ASN A:42 , GLN A:128 , LEU A:150 , GLN A:151 , HIS A:152 , LYS A:189 , HOH A:2089 , HOH A:2211 , HOH A:2296 , HOH A:2297 , HOH A:2298BINDING SITE FOR RESIDUE FMN A1203

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2WQF)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Asn A:154 -Pro A:155

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2WQF)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2WQF)

(-) Exons   (0, 0)

(no "Exon" information available for 2WQF)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:189
 aligned with Q9CED0_LACLA | Q9CED0 from UniProtKB/TrEMBL  Length:202

    Alignment length:201
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201 
         Q9CED0_LACLA     2 SFIKSLENRRTIYALGRNVQDEEKVIETIKEAVRFSPTAFNSQTGRLLILTGDAQDKLWDEIVAPELKAAMEAQGVPESAWDNTRAKLDGFKAAFGTILFFEDQAVVKNLQEQFALYADNFPVWSEQGSGIISVNVWTALAELGLGANLQHYNPLIDEAVAKEWNLPESWKLRGQLVFGSIEAPAGEKTFMDDADRFIVAK 202
               SCOP domains d2wqfa_ A: automated matches                                                                                                                                                                              SCOP domains
               CATH domains 2wqfA00 A:2-202 NADH Oxidase                                                                                                                                                                              CATH domains
               Pfam domains -----Nitroreductase-2wqfA01 A:7-181                                                                                                                                                 --------------------- Pfam domains
         Sec.struct. author hhhhhhhhh...........hhhhhhhhhhhhhhh..hhhhh....eee...hhhhhhhhhhhhhhhhhhhhh------------............eeeeeehhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh....ee......hhhhhhhhh.....eee...ee..............hhhhh..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wqf A   2 SFIKSLENRRTIYALGRNVQDEEKVIETIKEAVRFSPTAFNSQTGRLLILTGDAQDKLWDEIVAPELKAAMEA------------AKLDGFKAAFGTILFFEDQAVVKNLQEQFALYADNFPVWSEQGSGIISVNVWTALAELGLGANLQHYNPLIDEAVAKEWNLPESWKLRGQLVFGSIEAPAGEKTFMDDADRFIVAK 202
                                    11        21        31        41        51        61        71  |      -     |  91       101       111       121       131       141       151       161       171       181       191       201 
                                                                                                   74           87
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric Unit
(-)
Clan: no clan defined [family: Nitroreductase] (9)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q9CED0_LACLA | Q9CED0)
molecular function
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:154 - Pro A:155   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2wqf
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9CED0_LACLA | Q9CED0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9CED0_LACLA | Q9CED0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q9CED0_LACLA | Q9CED0: 4bn6 4bn7 4bn8 4bn9 4bnb

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2WQF)