2WLB - JenaLib

Title :   ADRENODOXIN-LIKE FERREDOXIN ETP1FD(516-618) OF SCHIZOSACCHAROMYCES POMBE MITOCHONDRIA

Authors :   J. J. Mueller, F. Hannemann, B. Schiffler, R. Bernhardt, U. Heinemann

Date :   23 Jun 09 (Deposition) - 25 Aug 10 (Release) - 25 May 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.60

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: A,B  (1x)

Keywords :   Iron-Sulfur, Mitochondria, Iron, Transport, Ferredoxin, Adrenodoxin-Like, Electron Transport, Metal-Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. J. Mueller, F. Hannemann, B. Schiffler, K. M. Ewen, R. Kappl, U. Heinemann, R. Bernhardt
Structural And Thermodynamic Characterization Of The Adrenodoxin-Like Domain Of The Electron- Transfer Protein Etp1 From Schizosaccharomyces Pombe.
J. Inorg. Biochem. V. 105 957 2011
PubMed-ID: 21536008 | Reference-DOI: 10.1016/J.JINORGBIO.2011.04.001

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ADX	PS00814	Adrenodoxin family, iron-sulfur binding region signature.	ETP1_SCHPO	541-551	2	A:556-566 B:556-566

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ADX	PS00814	Adrenodoxin family, iron-sulfur binding region signature.	ETP1_SCHPO	541-551	1	A:556-566 -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ADX	PS00814	Adrenodoxin family, iron-sulfur binding region signature.	ETP1_SCHPO	541-551	1	- B:556-566

Biological Unit 3 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ADX	PS00814	Adrenodoxin family, iron-sulfur binding region signature.	ETP1_SCHPO	541-551	2	A:556-566 B:556-566

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:103
 aligned with ETP1_SCHPO | Q10361 from UniProtKB/Swiss-Prot  Length:616

    Alignment length:103
                                               537             538                                                                 
                                   525       535 |       -       540       550       560       570       580       590       600   
           ETP1_SCHPO   516 GTGIKVFFVTPEGREIMIEGNE---------------EGACEGSVACSTCHVIVDPEHYELLDPPEEDEEDMLDLAFGLEETSRLGCQVLLRKDLDGIRVRIP 603
               SCOP domains d2wlba_ A: automated matches                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeee.....eeeeee....hhhhhhhhh.................eeeehhhhhhhh...hhhhhhhhh........eee......hhhhh.eeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------ADX        ---------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 2wlb A 516 GTGIKVFFVTPEGREIMIEGNEGDSILDLAHANNIDLEGACEGSVACSTCHVIVDPEHYELLDPPEEDEEDMLDLAFGLEETSRLGCQVLLRKDLDGIRVRIP 618
                                   525       535       545       555       565       575       585       595       605       615

Chain B from PDB  Type:PROTEIN  Length:101
 aligned with ETP1_SCHPO | Q10361 from UniProtKB/Swiss-Prot  Length:616

    Alignment length:101
                                             537             538                                                                 
                                   527       537         -     | 542       552       562       572       582       592       602 
           ETP1_SCHPO   518 GIKVFFVTPEGREIMIEGNE---------------EGACEGSVACSTCHVIVDPEHYELLDPPEEDEEDMLDLAFGLEETSRLGCQVLLRKDLDGIRVRIP 603
               SCOP domains d2wlbb_ B: automated matches                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) Fer2-2wlbB01 B:518-607                                                                    ----------- Pfam domains (1)
           Pfam domains (2) Fer2-2wlbB02 B:518-607                                                                    ----------- Pfam domains (2)
         Sec.struct. author .eeeeee.....eeeeee....hhhhhhhhh.................eeeehhhhhhhh...hhhhhhhhhh.......eee......hhhhh.eeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------ADX        ---------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------- Transcript
                 2wlb B 518 GIKVFFVTPEGREIMIEGNEGDSILDLAHANNIDLEGACEGSVACSTCHVIVDPEHYELLDPPEEDEEDMLDLAFGLEETSRLGCQVLLRKDLDGIRVRIP 618
                                   527       537       547       557       567       577       587       597       607       617

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (18, 18)

Asymmetric Unit(hide GO term definitions)

Chain A,B (ETP1_SCHPO | Q10361)

molecular function
	GO:0051537	2 iron, 2 sulfur cluster binding	Interacting selectively and non-covalently with a 2 iron, 2 sulfur (2Fe-2S) cluster; this cluster consists of two iron atoms, with two inorganic sulfur atoms found between the irons and acting as bridging ligands.
	GO:0004129	cytochrome-c oxidase activity	Catalysis of the reaction: 4 ferrocytochrome c + O2 + 4 H+ = 4 ferricytochrome c + 2 H2O.
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0051536	iron-sulfur cluster binding	Interacting selectively and non-covalently with an iron-sulfur cluster, a combination of iron and sulfur atoms.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016653	oxidoreductase activity, acting on NAD(P)H, heme protein as acceptor	Catalysis of an oxidation-reduction (redox) reaction in which NADH or NADPH acts as a hydrogen or electron donor and reduces a heme protein.
	GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors	Catalysis of an oxidation-reduction (redox) reaction in which a CH-CH group acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
biological process
	GO:0022900	electron transport chain	A process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0006784	heme a biosynthetic process	The chemical reactions and pathways resulting in the formation of heme a, a derivative of heme found in cytochrome aa3.
	GO:1902600	hydrogen ion transmembrane transport	The directed movement of hydrogen ion (proton) across a membrane.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0008535	respiratory chain complex IV assembly	The aggregation, arrangement and bonding together of a set of components to form respiratory chain complex IV (also known as cytochrome c oxidase), the terminal member of the respiratory chain of the mitochondrion and some aerobic bacteria. Cytochrome c oxidases are multi-subunit enzymes containing from 13 subunits in the mammalian mitochondrial form to 3-4 subunits in the bacterial forms.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0031305	integral component of mitochondrial inner membrane	The component of the mitochondrial inner membrane consisting of the gene products having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0031966	mitochondrial membrane	Either of the lipid bilayers that surround the mitochondrion and form the mitochondrial envelope.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FES	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2wlb)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2wlb
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ETP1_SCHPO \| Q10361
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description