2WJI - JenaLib

Title :   STRUCTURE AND FUNCTION OF THE FEOB G-DOMAIN FROM METHANOCOCCUS JANNASCHII

Authors :   S. Koester, M. Wehner, C. Herrmann, W. Kuehlbrandt, O. Yildiz

Date :   26 May 09 (Deposition) - 28 Jul 09 (Release) - 25 May 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Membrane G-Proteins, Ferrous Iron Transport, Cell Membrane, Ion Transport, Transmembrane, Nucleotide Binding Motifs, Metal Transport, Iron, Gnbps, Membrane, Transport, Gtp-Binding, Iron Transport, Nucleotide-Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Koester, M. Wehner, C. Herrmann, W. Kuehlbrandt, O. Yildiz
Structure And Function Of The Feob G-Domain From Methanococcus Jannaschii
J. Mol. Biol. V. 392 405 2009
PubMed-ID: 19615379 | Reference-DOI: 10.1016/J.JMB.2009.07.020

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 5)

Sites (5, 5)

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	PRO A:12 , ASN A:13 , VAL A:14 , GLY A:15 , LYS A:16 , SER A:17 , THR A:18 , ASN A:116 , LYS A:117 , ASP A:119 , SER A:145 , ALA A:146 , ALA A:147 , MG A:1167 , HOH A:2013 , HOH A:2073 , HOH A:2088 , HOH A:2089 , HOH A:2092 , HOH A:2093 , HOH A:2094	BINDING SITE FOR RESIDUE GNP A1166
2	AC2	SOFTWARE	SER A:17 , GNP A:1166 , HOH A:2031 , HOH A:2046 , HOH A:2093	BINDING SITE FOR RESIDUE MG A1167
3	AC3	SOFTWARE	PRO B:12 , ASN B:13 , VAL B:14 , GLY B:15 , LYS B:16 , SER B:17 , THR B:18 , ASN B:116 , LYS B:117 , ASP B:119 , SER B:145 , ALA B:146 , ALA B:147 , MG B:1167 , HOH B:2011 , HOH B:2032 , HOH B:2073 , HOH B:2074 , HOH B:2075 , HOH B:2076 , HOH B:2077 , HOH B:2078 , HOH B:2079 , HOH B:2081	BINDING SITE FOR RESIDUE GNP B1166
4	AC4	SOFTWARE	SER B:17 , GNP B:1166 , HOH B:2022 , HOH B:2032 , HOH B:2077	BINDING SITE FOR RESIDUE MG B1167
5	AC5	SOFTWARE	ASN A:13 , ARG A:96 , ASN B:13 , ARG B:96 , HOH B:2082	BINDING SITE FOR RESIDUE PO4 B1168

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:160
 aligned with FEOB_METJA | Q57986 from UniProtKB/Swiss-Prot  Length:668

    Alignment length:165
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160     
           FEOB_METJA     1 MKSYEIALIGNPNVGKSTIFNALTGENVYIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANSIDEIIARDYIINEKPDLVVNIVDATALERNLYLTLQLMEMGANLLLALNKMDLAKSLGIEIDVDKLEKILGVKVVPLSAAKKMGIEDLKKAISIAVKD 165
               SCOP domains d2wjia_ A: automated matches                                                                                                                                          SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee.....hhhhhhhhhhh......-----.....eeeeee..eeeeeee..........hhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhhhhh...eeeeeehhhhhhhh....hhhhhhhhhh..eee..hhhh.hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --G_FEOB  PDB: A:3-165 UniProt: 3-165                                                                                                                                 PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wji A   1 MKSYEIALIGNPNVGKSTIFNALTGENVYIG-----TVEKKEGEFEYNGEKFKVVDLPGVYSLTANSIDEIIARDYIINEKPDLVVNIVDATALERNLYLTLQLMEMGANLLLALNKMDLAKSLGIEIDVDKLEKILGVKVVPLSAAKKMGIEELKKAISIAVKD 165
                                    10        20        30|     | 40        50        60        70        80        90       100       110       120       130       140       150       160     
                                                         31    37

Chain B from PDB  Type:PROTEIN  Length:156
 aligned with FEOB_METJA | Q57986 from UniProtKB/Swiss-Prot  Length:668

    Alignment length:165
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160     
           FEOB_METJA     1 MKSYEIALIGNPNVGKSTIFNALTGENVYIGNWPGVTVEKKEGEFEYNGEKFKVVDLPGVYSLTANSIDEIIARDYIINEKPDLVVNIVDATALERNLYLTLQLMEMGANLLLALNKMDLAKSLGIEIDVDKLEKILGVKVVPLSAAKKMGIEDLKKAISIAVKD 165
               SCOP domains d2wjib_ B: automated matches                                                                                                                                          SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---FeoB_N-2wjiB01 B:4-165                                                                                                                                             Pfam domains (1)
           Pfam domains (2) ---FeoB_N-2wjiB02 B:4-165                                                                                                                                             Pfam domains (2)
         Sec.struct. author ..eeeeeee.....hhhhhhhhhhh...---------....eeeeee..eeeeeee..........hhhhhhhhhhhhhh...eeeeeee..hhhhhhhhhhhhhhh...eeeeeehhhhhhhh....hhhhhhhhhh..eee..hhhh.hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --G_FEOB  PDB: B:3-165 UniProt: 3-165                                                                                                                                 PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wji B   1 MKSYEIALIGNPNVGKSTIFNALTGENV---------VEKKEGEFEYNGEKFKVVDLPGVYSLTANSIDEIIARDYIINEKPDLVVNIVDATALERNLYLTLQLMEMGANLLLALNKMDLAKSLGIEIDVDKLEKILGVKVVPLSAAKKMGIEELKKAISIAVKD 165
                                    10        20       | -       |40        50        60        70        80        90       100       110       120       130       140       150       160     
                                                      28        38

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (11, 11)

Asymmetric Unit(hide GO term definitions)

Chain A,B (FEOB_METJA | Q57986)

molecular function
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0015093	ferrous iron transmembrane transporter activity	Enables the transfer of ferrous iron (Fe(II) or Fe2+) ions from one side of a membrane to the other.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
	GO:1903874	ferrous iron transmembrane transport	The directed movement of ferrous iron (iron(2+)) across a membrane.
	GO:0015684	ferrous iron transport	The directed movement of ferrous iron (Fe(II) or Fe2+) ions into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0055072	iron ion homeostasis	Any process involved in the maintenance of an internal steady state of iron ions within an organism or cell.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GNP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2wji)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2wji
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	FEOB_METJA \| Q57986
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description