Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE NATIVE CRYSTAL STRUCTURE OF THE PRIMARY HEXOSE OXIDASE ( DBV29) IN ANTIBIOTIC A40926 BIOSYNTHESIS
 
Authors :  Y. -C. Liu, Y. -S. Li, S. -Y. Lyu, Y. -H. Chen, H. -C. Chan, C. -J. Huang, Y. -T. Huang, G. -H. Chen, C. -C. Chou, M. -D. Tsai, T. -L. Li
Date :  27 Mar 09  (Deposition) - 07 Apr 10  (Release) - 27 Apr 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.21
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Fad, Flavoprotein, Hexose Oxidase, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. -C. Liu, Y. -S. Li, S. -Y. Lyu, L. -J. Hsu, Y. -H. Chen, Y. -T. Huang, H. -C. Chan, C. -J. Huang, G. -H. Chen, C. -C. Chou, M. -D. Tsai, T. -L. Li
Interception Of Teicoplanin Oxidation Intermediates Yields New Antimicrobial Scaffolds
Nat. Chem. Biol. V. 7 304 2011
PubMed-ID: 21478878  |  Reference-DOI: 10.1038/NCHEMBIO.556

(-) Compounds

Molecule 1 - PUTATIVE HEXOSE OXIDASE
    Atcc39727
    ChainsA, B
    EC Number1.1.3.13
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28A
    Expression System StrainK-12
    Expression System Taxid83333
    Organism ScientificNONOMURAEA SP. ATCC 39727
    Organism Taxid93944
    SynonymPRIMARY HEXOSE OXIDASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1FAD2Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:86 , ARG A:87 , SER A:88 , GLY A:89 , GLY A:90 , HIS A:91 , CYS A:92 , PHE A:93 , PHE A:96 , GLY A:149 , VAL A:150 , CYS A:151 , VAL A:154 , GLY A:155 , GLY A:157 , GLY A:158 , HIS A:159 , TYR A:165 , GLY A:218 , GLY A:219 , VAL A:224 , TYR A:470 , ASN A:472BINDING SITE FOR RESIDUE FAD A 601
2AC2SOFTWAREVAL B:86 , ARG B:87 , SER B:88 , GLY B:89 , GLY B:90 , HIS B:91 , CYS B:92 , PHE B:96 , VAL B:97 , GLY B:149 , VAL B:150 , CYS B:151 , VAL B:154 , GLY B:155 , GLY B:157 , GLY B:158 , HIS B:159 , GLY B:164 , TYR B:165 , GLY B:218 , GLY B:219 , VAL B:224 , TYR B:470 , ASN B:472BINDING SITE FOR RESIDUE FAD B 601

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:26 -B:26

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2WDW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2WDW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2WDW)

(-) Exons   (0, 0)

(no "Exon" information available for 2WDW)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:498
 aligned with Q7WZ62_9ACTN | Q7WZ62 from UniProtKB/TrEMBL  Length:523

    Alignment length:498
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515        
         Q7WZ62_9ACTN    26 CLPPAGPVKVTPDDPRYLNLKLRGANSRFNGEPDYIHLVGSTQQVADAVEETVRTGKRVAVRSGGHCFEDFVDNPDVKVIIDMSLLTEIAYDPSMNAFLIEPGNTLSEVYEKLYLGWNVTIPGGVCGGVGVGGHICGGGYGPLSRQFGSVVDYLYAVEVVVVNKQGKARVIVATRERDDPHHDLWWAHTGGGGGNFGVVTKYWMRVPEDVGRNPERLLPKPPATLLTSTVTFDWAGMTEAAFSRLLRNHGEWYERNSGPDSPYTGLWSQLMIGNEVPGMGESGFMMPIQVDATRPDARRLLDAHIEAVIDGVPPAEVPEPIEQRWLASTPGRGGRGPASKTKAGYLRKRLTDRQIQAVYENMTHMDGIDYGAVWLIGYGGKVNTVDPAATALPQRDAILKVNYITGWANPGNEAKHLTWVRKLYADVYAETGGVPVPNDVSDGAYINYPDSDLADPGLNTSGVPWHDLYYKGNHPRLRKVKAAYDPRNHFHHALSIRP 523
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eee.....hhhhhhh............eeee..hhhhhhhhhhhhhhhh..eeee................eeee......eeee....eeee....hhhhhhhhhhhhhh...........hhhhhhhh.....hhhhhhhhhh.eeeeeeeee.....eeeeeee......hhhhhhhh.........eeeeeee........hhhhh......eeeeeeeee.hhhhhhhhhhhhhhhhhhhhhh..........eeeeeeee..........eeeeeeee....hhhhhhhhhhhhhh.....ee....eeee.............eeeeeeeee....hhhhhhhhhhhhhh.....eeeeeeee.hhhhhhh.............eeeeeeeee.hhhhhhhhhhhhhhhhhhhhhhhh.................hhhhh.........hhhhhhhh.hhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2wdw A  26 CLPPAGPVKVTPDDPRYLNLKLRGANSRFNGEPDYIHLVGSTQQVADAVEETVRTGKRVAVRSGGHCFEDFVDNPDVKVIIDMSLLTEIAYDPSMNAFLIEPGNTLSEVYEKLYLGWNVTIPGGVCGGVGVGGHICGGGYGPLSRQFGSVVDYLYAVEVVVVNKQGKARVIVATRERDDPHHDLWWAHTGGGGGNFGVVTKYWMRVPEDVGRNPERLLPKPPATLLTSTVTFDWAGMTEAAFSRLLRNHGEWYERNSGPDSPYTGLWSQLMIGNEVPGMGESGFMMPIQVDATRPDARRLLDAHIEAVIDGVPPAEVPEPIEQRWLASTPGRGGRGPASKTKAGYLRKRLTDRQIQAVYENMTHMDGIDYGAVWLIGYGGKVNTVDPAATALPQRDAILKVNYITGWANPGNEAKHLTWVRKLYADVYAETGGVPVPNDVSDGAYINYPDSDLADPGLNTSGVPWHDLYYKGNHPRLRKVKAAYDPRNHFHHALSIRP 523
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515        

Chain B from PDB  Type:PROTEIN  Length:498
 aligned with Q7WZ62_9ACTN | Q7WZ62 from UniProtKB/TrEMBL  Length:523

    Alignment length:498
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515        
         Q7WZ62_9ACTN    26 CLPPAGPVKVTPDDPRYLNLKLRGANSRFNGEPDYIHLVGSTQQVADAVEETVRTGKRVAVRSGGHCFEDFVDNPDVKVIIDMSLLTEIAYDPSMNAFLIEPGNTLSEVYEKLYLGWNVTIPGGVCGGVGVGGHICGGGYGPLSRQFGSVVDYLYAVEVVVVNKQGKARVIVATRERDDPHHDLWWAHTGGGGGNFGVVTKYWMRVPEDVGRNPERLLPKPPATLLTSTVTFDWAGMTEAAFSRLLRNHGEWYERNSGPDSPYTGLWSQLMIGNEVPGMGESGFMMPIQVDATRPDARRLLDAHIEAVIDGVPPAEVPEPIEQRWLASTPGRGGRGPASKTKAGYLRKRLTDRQIQAVYENMTHMDGIDYGAVWLIGYGGKVNTVDPAATALPQRDAILKVNYITGWANPGNEAKHLTWVRKLYADVYAETGGVPVPNDVSDGAYINYPDSDLADPGLNTSGVPWHDLYYKGNHPRLRKVKAAYDPRNHFHHALSIRP 523
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eee.....hhhhhhh............eeee..hhhhhhhhhhhhhhhh..eeee................eeee......eeee....eeee....hhhhhhhhhhhhhh...........hhhhhhhh.....hhhhhhhhhh.eeeeeeeee.....eeeeeee......hhhhhhhh.........eeeeeee........hhhhh......eeeeeeeee.hhhhhhhhhhhhhhhhhhhhhhh....hhhh.eeeeeeee..........eeeeeeee....hhhhhhhhhhhhhh.....ee....eeee.............eeeeeeeee....hhhhhhhhhhhhhh.....eeeeeeee.hhhhhhh.............eeeeeeeee.hhhhhhhhhhhhhhhhhhhhhhhh.................hhhhh.........hhhhhhh..hhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2wdw B  26 CLPPAGPVKVTPDDPRYLNLKLRGANSRFNGEPDYIHLVGSTQQVADAVEETVRTGKRVAVRSGGHCFEDFVDNPDVKVIIDMSLLTEIAYDPSMNAFLIEPGNTLSEVYEKLYLGWNVTIPGGVCGGVGVGGHICGGGYGPLSRQFGSVVDYLYAVEVVVVNKQGKARVIVATRERDDPHHDLWWAHTGGGGGNFGVVTKYWMRVPEDVGRNPERLLPKPPATLLTSTVTFDWAGMTEAAFSRLLRNHGEWYERNSGPDSPYTGLWSQLMIGNEVPGMGESGFMMPIQVDATRPDARRLLDAHIEAVIDGVPPAEVPEPIEQRWLASTPGRGGRGPASKTKAGYLRKRLTDRQIQAVYENMTHMDGIDYGAVWLIGYGGKVNTVDPAATALPQRDAILKVNYITGWANPGNEAKHLTWVRKLYADVYAETGGVPVPNDVSDGAYINYPDSDLADPGLNTSGVPWHDLYYKGNHPRLRKVKAAYDPRNHFHHALSIRP 523
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2WDW)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2WDW)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2WDW)

(-) Gene Ontology  (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q7WZ62_9ACTN | Q7WZ62)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0050660    flavin adenine dinucleotide binding    Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
    GO:0004497    monooxygenase activity    Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016614    oxidoreductase activity, acting on CH-OH group of donors    Catalysis of an oxidation-reduction (redox) reaction in which a CH-OH group act as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
    GO:0016757    transferase activity, transferring glycosyl groups    Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2wdw)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2wdw
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q7WZ62_9ACTN | Q7WZ62
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.1.3.13
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q7WZ62_9ACTN | Q7WZ62
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q7WZ62_9ACTN | Q7WZ624k3t 5awv

(-) Related Entries Specified in the PDB File

2wdx THE COMPLEXED CRYSTAL STRUCTURE OF THE PRIMARY HEXOSE OXIDASE (DBV29) IN ANTIBIOTIC A40926 BIOSYNTHESIS