Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THREE-DIMENSIONAL STRUCTURE OF THE NITROGEN FIXATION FLAVODOXIN (NIFF) FROM RHODOBACTER CAPSULATUS AT 2.2 A
 
Authors :  I. Perez-Dorado, C. Bittel, J. A. Hermoso, N. Cortez, N. Carrillo
Date :  06 Mar 09  (Deposition) - 21 Apr 10  (Release) - 30 Jul 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.17
Chains :  Asym./Biol. Unit :  A
Keywords :  Electron Transport, Flavoprotein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  I. Perez-Dorado, A. Bortolotti, N. Cortez, J. A. Hermoso
Structural And Phylogenetic Analysis Of Rhodobacter Capsulatus Niff: Uncovering General Features Of Nitrogen- Fixation (Nif)-Flavodoxins.
Int. J. Mol. Sci. V. 14 1152 2013
PubMed-ID: 23303276  |  Reference-DOI: 10.3390/IJMS14011152
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FLAVODOXIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET32-FLD
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    Organism ScientificRHODOBACTER CAPSULATUS
    Organism Taxid1061

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1FMN1Ligand/IonFLAVIN MONONUCLEOTIDE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:10 , ASP A:11 , THR A:12 , GLY A:13 , THR A:14 , THR A:15 , PRO A:56 , THR A:57 , GLY A:59 , GLY A:61 , LEU A:97 , GLY A:98 , ASP A:99 , TYR A:103 , GLU A:106 , PHE A:107 , VAL A:108 , ASP A:155 , HOH A:2007 , HOH A:2009 , HOH A:2073 , HOH A:2074BINDING SITE FOR RESIDUE FMN A 183

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2WC1)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2WC1)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2WC1)

(-) PROSITE Motifs  (2, 2)

Asymmetric/Biological Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FLAVODOXIN_LIKEPS50902 Flavodoxin-like domain profile.FLAV_RHOCB4-173  1A:4-173
2FLAVODOXINPS00201 Flavodoxin signature.FLAV_RHOCB6-22  1A:6-22

(-) Exons   (0, 0)

(no "Exon" information available for 2WC1)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:182
 aligned with FLAV_RHOCB | P52967 from UniProtKB/Swiss-Prot  Length:182

    Alignment length:182
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180  
           FLAV_RHOCB     1 MAKIGLFFGSDTGTTRKIAKQIKDMFDDEVMAKPLNVNRADVADFMAYDFLILGTPTLGDGQLPGLSANAASESWEEFLPRIADQDFSGKTIALFGLGDQVTYPLEFVNALFFLHEFFSDRGAKLVGRWPAKGYGFEDSLAVVEGEFLGLALDQDNQAALTPERLKGWLSLIAADFGLVLPA 182
               SCOP domains d2wc1a_ A: automated matches                                                                                                                                                           SCOP domains
               CATH domains 2wc1A00 A:1-182  [code=3.40.50.360, no name defined]                                                                                                                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee....hhhhhhhhhhhh..........ee.hhhhhhhhhhh.eeeeeee........hhhhh....hhhhhhhhhh.......eeeeeee...........hhhhhhhhhhhh...eee..ee...........ee..ee..eee....hhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---FLAVODOXIN_LIKE  PDB: A:4-173 UniProt: 4-173                                                                                                                              --------- PROSITE (1)
                PROSITE (2) -----FLAVODOXIN       ---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2wc1 A   1 MAKIGLFFGSDTGTTRKIAKQIKDMFDDEVMAKPLNVNRADVADFMAYDFLILGTPTLGDGQLPGLSANAASESWEEFLPRIADQDFSGKTIALFGLGDQVTYPLEFVNALFFLHEFFSDRGANVVGRWPAKGYGFEDSLAVVEGEFLGLALDQDNQAALTPERLKGWLSLIAADFGLVLPA 182
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2WC1)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (FLAV_RHOCB | P52967)
molecular function
    GO:0010181    FMN binding    Interacting selectively and non-covalently with flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
biological process
    GO:0009399    nitrogen fixation    The process in which nitrogen is taken from its relatively inert molecular form (N2) in the atmosphere and converted into nitrogen compounds useful for other chemical processes, such as ammonia, nitrate and nitrogen dioxide.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2wc1)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2wc1
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FLAV_RHOCB | P52967
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FLAV_RHOCB | P52967
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2WC1)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2WC1)