|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2W0R) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2W0R) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2W0R) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2W0R) |
Exons (0, 0)| (no "Exon" information available for 2W0R) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:122 aligned with Q56844_YEREN | Q56844 from UniProtKB/TrEMBL Length:354 Alignment length:122 231 241 251 261 271 281 291 301 311 321 331 341 Q56844_YEREN 222 KREYKEMEGSPEIKSKRRQFHQEIQSGNMRENVKRSSVVVANPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRWLER 343 SCOP domains -------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains 2w0rA00 A:222-343 secretion proteins EscU CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript 2w0r A 222 KREYKEMEGSPEIKSKRRQFHQEIQSGNMRENVKRSSVVVADPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRWLER 343 231 241 251 261 271 281 291 301 311 321 331 341
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2W0R) |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2W0R) |
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (Q56844_YEREN | Q56844)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|