Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE GUANYLYL CYCLASE CYA2
 
Authors :  A. Rauch, M. Leipelt, M. Russwurm, C. Steegborn
Date :  08 Aug 08  (Deposition) - 30 Sep 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.31
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Biol. Unit 3:  E,F  (1x)
Keywords :  Guanylyl Cyclase, Class Iii Nucleotidyl Cyclase, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Rauch, M. Leipelt, M. Russwurm, C. Steegborn
Crystal Structure Of The Guanylyl Cyclase Cya2.
Proc. Nat. Acad. Sci. Usa V. 105 15720 2008
PubMed-ID: 18840690  |  Reference-DOI: 10.1073/PNAS.0808473105

(-) Compounds

Molecule 1 - ADENYLATE CYCLASE
    Chains: A, B, C, D, E, F
    EC Number: 4.6.1.2
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Fragment: CATALYTIC DOMAIN, RESIDUES 434-635
    Organism Scientific: SYNECHOCYSTIS SP.
    Organism Taxid: 1148
    Strain: PCC 6803
    Synonym: GUANYLYL CYCLASE CYA2

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEF
Biological Unit 1 (1x): AB    
Biological Unit 2 (1x):   CD  
Biological Unit 3 (1x):     EF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2W01)

(-) Sites  (0, 0)

(no "Site" information available for 2W01)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2W01)

(-) Cis Peptide Bonds  (12, 12)

Asymmetric Unit
No.Residues
1Ala A:500 -Pro A:501
2Glu A:624 -Pro A:625
3Ala B:500 -Pro B:501
4Glu B:624 -Pro B:625
5Ala C:500 -Pro C:501
6Glu C:624 -Pro C:625
7Ala D:500 -Pro D:501
8Glu D:624 -Pro D:625
9Ala E:500 -Pro E:501
10Glu E:624 -Pro E:625
11Ala F:500 -Pro F:501
12Glu F:624 -Pro F:625

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2W01)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2W01)

(-) Exons   (0, 0)

(no "Exon" information available for 2W01)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:201
 aligned with P72951_SYNY3 | P72951 from UniProtKB/TrEMBL  Length:756

    Alignment length:201
                                   444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634 
         P72951_SYNY3   435 MGGDRRPITILTSDLRGFTSTSEGLNPEEVVKVLNIYFGKMADVITHHGGTIDEFMGDGILVLFGAPTSQQDDALRAVACGVEMQLALREVNQQVTGLGLQPLEMGIGINTGEVVVGNIGSEKRTKYGVVGAQVNLTYRIESYTTGGQIFISSTTLEAAGDRVHVNGNRTVQPKGVKDPVVIWDVAGVGEPYNLSLAVEEQ 635
               SCOP domains d2w01a_ A: automated matches                                                                                                                                                                              SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee..eeeeee.......hhhhhhhhhhhhhhhhhhhhhhhhhh........eeeeeeeeeeeeeee....eeeeeehhhhhhhhhhhhh.....eeeehhhhhhhh...................eeeeeeeee............. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2w01 A 435 MGGDRRPITILTSDLRGFTSTSEGLNPEEVVKVLNIYFGKMADVITHHGGTIDEFMGDGILVLFGAPTSQQDDALRAVACGVEMQLALREVNQQVTGLGLQPLEMGIGINTGEVVVGNIGSEKRTKYGVVGAQVNLTYRIESYTTGGQIFISSTTLEAAGDRVHVNGNRTVQPKGVKDPVVIWDVAGVGEPYNLSLAVEEQ 635
                                   444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634 


Chain B from PDB  Type:PROTEIN  Length:197
 aligned with P72951_SYNY3 | P72951 from UniProtKB/TrEMBL  Length:756

    Alignment length:197
                                   444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       
         P72951_SYNY3   435 MGGDRRPITILTSDLRGFTSTSEGLNPEEVVKVLNIYFGKMADVITHHGGTIDEFMGDGILVLFGAPTSQQDDALRAVACGVEMQLALREVNQQVTGLGLQPLEMGIGINTGEVVVGNIGSEKRTKYGVVGAQVNLTYRIESYTTGGQIFISSTTLEAAGDRVHVNGNRTVQPKGVKDPVVIWDVAGVGEPYNLSLA 631
               SCOP domains d2w01b_ B: automated matches                                                                                                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeeee.hhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh..eeeeee..eeeeee.......hhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeeeeeeeeeeee......eeeeehhhhhhhhhhhhh.....eeeehhhhhhhh...................eeeeeeeee......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2w01 B 435 MGGDRRPITILTSDLRGFTSTSEGLNPEEVVKVLNIYFGKMADVITHHGGTIDEFMGDGILVLFGAPTSQQDDALRAVACGVEMQLALREVNQQVTGLGLQPLEMGIGINTGEVVVGNIGSEKRTKYGVVGAQVNLTYRIESYTTGGQIFISSTTLEAAGDRVHVNGNRTVQPKGVKDPVVIWDVAGVGEPYNLSLA 631
                                   444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       


Chain C from PDB  Type:PROTEIN  Length:200
 aligned with P72951_SYNY3 | P72951 from UniProtKB/TrEMBL  Length:756

    Alignment length:200
                                   443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633
         P72951_SYNY3   434 KMGGDRRPITILTSDLRGFTSTSEGLNPEEVVKVLNIYFGKMADVITHHGGTIDEFMGDGILVLFGAPTSQQDDALRAVACGVEMQLALREVNQQVTGLGLQPLEMGIGINTGEVVVGNIGSEKRTKYGVVGAQVNLTYRIESYTTGGQIFISSTTLEAAGDRVHVNGNRTVQPKGVKDPVVIWDVAGVGEPYNLSLAVE 633
               SCOP domains d2w01c_ C: automated matches                                                                                                                                                                             SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeeeeee.hhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh..eeeeee..eeeeee.......hhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeeeeeeeeeee....eeeeeehhhhhhhhhhhhh.....eeehhhhhhhhh...................eeeeeeeee........... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2w01 C 434 KMGGDRRPITILTSDLRGFTSTSEGLNPEEVVKVLNIYFGKMADVITHHGGTIDEFMGDGILVLFGAPTSQQDDALRAVACGVEMQLALREVNQQVTGLGLQPLEMGIGINTGEVVVGNIGSEKRTKYGVVGAQVNLTYRIESYTTGGQIFISSTTLEAAGDRVHVNGNRTVQPKGVKDPVVIWDVAGVGEPYNLSLAVE 633
                                   443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633


Chain D from PDB  Type:PROTEIN  Length:199
 aligned with P72951_SYNY3 | P72951 from UniProtKB/TrEMBL  Length:756

    Alignment length:199
                                   443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623         
         P72951_SYNY3   434 KMGGDRRPITILTSDLRGFTSTSEGLNPEEVVKVLNIYFGKMADVITHHGGTIDEFMGDGILVLFGAPTSQQDDALRAVACGVEMQLALREVNQQVTGLGLQPLEMGIGINTGEVVVGNIGSEKRTKYGVVGAQVNLTYRIESYTTGGQIFISSTTLEAAGDRVHVNGNRTVQPKGVKDPVVIWDVAGVGEPYNLSLAV 632
               SCOP domains d2w01d_ D: automated matches                                                                                                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeeeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee..eeeeee.......hhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeeeeeeeeee......eeeeehhhhhhhhhhhhh.........hhhhhhhh..eeeeeeeee........eeeeeeeee.....ee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2w01 D 434 KMGGDRRPITILTSDLRGFTSTSEGLNPEEVVKVLNIYFGKMADVITHHGGTIDEFMGDGILVLFGAPTSQQDDALRAVACGVEMQLALREVNQQVTGLGLQPLEMGIGINTGEVVVGNIGSEKRTKYGVVGAQVNLTYRIESYTTGGQIFISSTTLEAAGDRVHVNGNRTVQPKGVKDPVVIWDVAGVGEPYNLSLAV 632
                                   443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623         


Chain E from PDB  Type:PROTEIN  Length:199
 aligned with P72951_SYNY3 | P72951 from UniProtKB/TrEMBL  Length:756

    Alignment length:199
                                   443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623         
         P72951_SYNY3   434 KMGGDRRPITILTSDLRGFTSTSEGLNPEEVVKVLNIYFGKMADVITHHGGTIDEFMGDGILVLFGAPTSQQDDALRAVACGVEMQLALREVNQQVTGLGLQPLEMGIGINTGEVVVGNIGSEKRTKYGVVGAQVNLTYRIESYTTGGQIFISSTTLEAAGDRVHVNGNRTVQPKGVKDPVVIWDVAGVGEPYNLSLAV 632
               SCOP domains d2w01e_ E: automated matches                                                                                                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeeeeeeee..hhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh..eeeeee..eeeeee.......hhhhhhhhhhhhhhhhhhhhhhhhhh........eeeeeeeeeeeeeee....eeeeeehhhhhhhhhhhhh.........hhhhhhhh..eeeeeeeee........eeeeeeeee.....ee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2w01 E 434 KMGGDRRPITILTSDLRGFTSTSEGLNPEEVVKVLNIYFGKMADVITHHGGTIDEFMGDGILVLFGAPTSQQDDALRAVACGVEMQLALREVNQQVTGLGLQPLEMGIGINTGEVVVGNIGSEKRTKYGVVGAQVNLTYRIESYTTGGQIFISSTTLEAAGDRVHVNGNRTVQPKGVKDPVVIWDVAGVGEPYNLSLAV 632
                                   443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623         


Chain F from PDB  Type:PROTEIN  Length:197
 aligned with P72951_SYNY3 | P72951 from UniProtKB/TrEMBL  Length:756

    Alignment length:197
                                   444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       
         P72951_SYNY3   435 MGGDRRPITILTSDLRGFTSTSEGLNPEEVVKVLNIYFGKMADVITHHGGTIDEFMGDGILVLFGAPTSQQDDALRAVACGVEMQLALREVNQQVTGLGLQPLEMGIGINTGEVVVGNIGSEKRTKYGVVGAQVNLTYRIESYTTGGQIFISSTTLEAAGDRVHVNGNRTVQPKGVKDPVVIWDVAGVGEPYNLSLA 631
               SCOP domains d2w01f_ F: automated matches                                                                                                                                                                          SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --Guanylate_cyc-2w01F01 F:437-620                                                                                                                                                         ----------- Pfam domains (1)
           Pfam domains (2) --Guanylate_cyc-2w01F02 F:437-620                                                                                                                                                         ----------- Pfam domains (2)
           Pfam domains (3) --Guanylate_cyc-2w01F03 F:437-620                                                                                                                                                         ----------- Pfam domains (3)
           Pfam domains (4) --Guanylate_cyc-2w01F04 F:437-620                                                                                                                                                         ----------- Pfam domains (4)
           Pfam domains (5) --Guanylate_cyc-2w01F05 F:437-620                                                                                                                                                         ----------- Pfam domains (5)
           Pfam domains (6) --Guanylate_cyc-2w01F06 F:437-620                                                                                                                                                         ----------- Pfam domains (6)
         Sec.struct. author ...eeeeeeeeeeee.hhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh..eeeee....eeeee.......hhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeeeeeeeeeee....eeeeeehhhhhhhhhhhhh.........hhhhhhhh..eee...eee........eeeeeeeee.....ee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2w01 F 435 MGGDRRPITILTSDLRGFTSTSEGLNPEEVVKVLNIYFGKMADVITHHGGTIDEFMGDGILVLFGAPTSQQDDALRAVACGVEMQLALREVNQQVTGLGLQPLEMGIGINTGEVVVGNIGSEKRTKYGVVGAQVNLTYRIESYTTGGQIFISSTTLEAAGDRVHVNGNRTVQPKGVKDPVVIWDVAGVGEPYNLSLA 631
                                   444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 6)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2W01)

(-) Pfam Domains  (1, 6)

Asymmetric Unit
(-)
Clan: Nucleot_cyclase (14)

(-) Gene Ontology  (10, 10)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F   (P72951_SYNY3 | P72951)
molecular function
    GO:0004016    adenylate cyclase activity    Catalysis of the reaction: ATP = 3',5'-cyclic AMP + diphosphate.
    GO:0016849    phosphorus-oxygen lyase activity    Catalysis of the cleavage of a phosphorus-oxygen bond by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond.
biological process
    GO:0006171    cAMP biosynthetic process    The chemical reactions and pathways resulting in the formation of the nucleotide cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate).
    GO:0009190    cyclic nucleotide biosynthetic process    The chemical reactions and pathways resulting in the formation of a cyclic nucleotide, a nucleotide in which the phosphate group is in diester linkage to two positions on the sugar residue.
    GO:0035556    intracellular signal transduction    The process in which a signal is passed on to downstream components within the cell, which become activated themselves to further propagate the signal and finally trigger a change in the function or state of the cell.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2w01)
 
  Sites
(no "Sites" information available for 2w01)
 
  Cis Peptide Bonds
    Ala A:500 - Pro A:501   [ RasMol ]  
    Ala B:500 - Pro B:501   [ RasMol ]  
    Ala C:500 - Pro C:501   [ RasMol ]  
    Ala D:500 - Pro D:501   [ RasMol ]  
    Ala E:500 - Pro E:501   [ RasMol ]  
    Ala F:500 - Pro F:501   [ RasMol ]  
    Glu A:624 - Pro A:625   [ RasMol ]  
    Glu B:624 - Pro B:625   [ RasMol ]  
    Glu C:624 - Pro C:625   [ RasMol ]  
    Glu D:624 - Pro D:625   [ RasMol ]  
    Glu E:624 - Pro E:625   [ RasMol ]  
    Glu F:624 - Pro F:625   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2w01
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  P72951_SYNY3 | P72951
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  4.6.1.2
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  P72951_SYNY3 | P72951
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2W01)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2W01)