|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2VU8) |
Sites (0, 0)| (no "Site" information available for 2VU8) |
SS Bonds (6, 6)
Asymmetric/Biological Unit
|
||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2VU8) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2VU8) |
PROSITE Motifs (3, 3)
Asymmetric/Biological Unit (3, 3)
|
||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2VU8) |
Sequences/Alignments
Asymmetric/Biological UnitChain E from PDB Type:PROTEIN Length:224 aligned with TRYP_FUSOX | P35049 from UniProtKB/Swiss-Prot Length:248 Alignment length:224 34 44 54 64 74 84 94 104 114 124 134 144 154 164 174 184 194 204 214 224 234 244 TRYP_FUSOX 25 IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA 248 SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains 2vu8E01 2vu8E02 E:28-120,E:233-242 Trypsin-like serine proteases 2vu8E01 E:16-27,E:121-232 Trypsin-like serine proteases 2vu8E02 CATH domains Pfam domains Trypsin-2vu8E01 E:16-238 ---- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) TRYPSIN_DOM PDB: E:16-242 UniProt: 25-248 PROSITE (1) PROSITE (2) ------------------------------------TRYPSI-----------------------------------------------------------------------------------------------------------------------------------TRYPSIN_SER --------------------------------------- PROSITE (2) Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2vu8 E 16 IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA 242 25 35| 46 56 |||| 62 ||| 73 || 86 96| 108 118 128 138 148 158 168 | 177 186 | 195 |204| 219 | 228 238 35| 59A||| 65A|| 76| 96| 173A 184A 188A 201A || 217| | 37 59B|| 66| 80 99 204| 219 | 59C| 69 209 221A 59D Chain I from PDB Type:PROTEIN Length:33 aligned with Q8WQ22_LOCMI | Q8WQ22 from UniProtKB/TrEMBL Length:145 Alignment length:33 34 44 54 Q8WQ22_LOCMI 25 ECTPGQTKKQDCNTCTCTPTGIWGCTRKACRTT 57 SCOP domains --------------------------------- SCOP domains CATH domains --------------------------------- CATH domains Pfam domains Pacifastin_I-2vu8I01 I:3-35 Pfam domains SAPs(SNPs) --------------------------------- SAPs(SNPs) PROSITE --------------------------------- PROSITE Transcript --------------------------------- Transcript 2vu8 I 3 ECTPGQTKKQDCNTCTCTPTGIWGCTRKACRTT 35 12 22 32
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2VU8) |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (2, 2)| Asymmetric/Biological Unit |
Gene Ontology (8, 10)|
Asymmetric/Biological Unit(hide GO term definitions) Chain E (TRYP_FUSOX | P35049)
Chain I (Q8WQ22_LOCMI | Q8WQ22)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|