![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2VT1) |
(no "Site" information available for 2VT1) |
(no "SS Bond" information available for 2VT1) |
(no "Cis Peptide Bond" information available for 2VT1) |
(no "SAP(SNP)/Variant" information available for 2VT1) |
(no "PROSITE Motif" information available for 2VT1) |
(no "Exon" information available for 2VT1) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:21 aligned with SPAS_SHIFL | P0A1M8 from UniProtKB/Swiss-Prot Length:342 Alignment length:21 246 256 SPAS_SHIFL 237 IEILSEQTKSDIRNSKLVVMN 257 SCOP domains d2vt1.1 SCOP domains CATH domains --------------------- CATH domains Pfam domains --------------------- Pfam domains SAPs(SNPs) --------------------- SAPs(SNPs) PROSITE --------------------- PROSITE Transcript --------------------- Transcript 2vt1 A 237 IEILSEQTKSDIRNSKLVVMN 257 246 256 Chain B from PDB Type:PROTEIN Length:81 aligned with SPAS_SHIFL | P0A1M8 from UniProtKB/Swiss-Prot Length:342 Alignment length:81 267 277 287 297 307 317 327 337 SPAS_SHIFL 258 PTHIAIGIYFNPEIAPAPFISLIETNQCALAVRKYANEVGIPTVRDVKLARKLYKTHTKYSFVDFEHLDEVLRLIVWLEQV 338 SCOP domains d2vt1.1 A:237-257,B:258-338 Surface presentation of antigens protein SpaS SCOP domains CATH domains --------------------------------------------------------------------------------- CATH domains Pfam domains (1) Bac_export_2-2vt1B01 B:258-336 -- Pfam domains (1) Pfam domains (2) Bac_export_2-2vt1B02 B:258-336 -- Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 2vt1 B 258 PTHIAIGIYFNPEIAPAPFISLIETNQCALAVRKYANEVGIPTVRDVKLARKLYKTHTKYSFVDFEHLDEVLRLIVWLEQV 338 267 277 287 297 307 317 327 337
|
Asymmetric/Biological Unit |
(no "CATH Domain" information available for 2VT1) |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (SPAS_SHIFL | P0A1M8)
|
|
|
|
|
|
|