|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 4)| Asymmetric/Biological Unit (3, 4) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2VQY) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2VQY) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2VQY) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2VQY) |
Exons (0, 0)| (no "Exon" information available for 2VQY) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:177 aligned with Q6SJ71_ECOLX | Q6SJ71 from UniProtKB/TrEMBL Length:199 Alignment length:179 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 Q6SJ71_ECOLX 21 DSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGRWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPYGPAVYMVQTRQAFERTRSDA 199 SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----Acetyltransf_8-2vqyA01 A:25 -185 -------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2vqy A 21 DSVTLRLMTEHDLAMLYEWLNRSHIVEWWGG--ARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDGWWEEETDPGVRGIDQLLANASQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVTTPDGPAVYMVQTRQAFERTRSDA 199 30 40 50| | 60 70 80 90 100 110 120 130 140 150 160 170 180 190 51 54
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2VQY) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2VQY) |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (5, 5)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q6SJ71_ECOLX | Q6SJ71)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|