Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  THE STRUCTURE OF ALLOPHYCOCYANIN FROM GLOEOBACTER VIOLACEUS
 
Authors :  J. W. Murray, S. Benson, J. Nield, J. Barber
Date :  13 Dec 07  (Deposition) - 25 Mar 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (6x)
Keywords :  Photosynthesis, Light Harvesting (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. W. Murray, S. Benson, J. Nield, J. Barber
The Structures Of The Phycobiliproteins Of Gloeobacter Violaceus
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - ALLOPHYCOCYANIN ALPHA SUBUNIT
    ChainsA
    Organism ScientificGLOEOBACTER VIOLACEUS
    Organism Taxid33072
    Other DetailsPASTEUR CULTURE COLLECTION
    StrainPCC7421
 
Molecule 2 - ALLOPHYCOCYANIN BETA SUBUNIT
    ChainsB
    Organism ScientificGLOEOBACTER VIOLACEUS
    Organism Taxid33072
    Other DetailsPASTEUR CULTURE COLLECTION
    StrainPCC7421

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (6x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric Unit (2, 3)
No.NameCountTypeFull Name
1CYC2Ligand/IonPHYCOCYANOBILIN
2MEN1Mod. Amino AcidN-METHYL ASPARAGINE
Biological Unit 1 (2, 18)
No.NameCountTypeFull Name
1CYC12Ligand/IonPHYCOCYANOBILIN
2MEN6Mod. Amino AcidN-METHYL ASPARAGINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:65 , ASN A:71 , ALA A:72 , MET A:77 , CYS A:81 , ARG A:83 , ASP A:84 , TYR A:87 , TYR A:88 , ILE A:107 , MET A:115 , TYR A:116 , LEU A:119 , THR A:121 , PRO A:122 , VAL A:126 , HOH A:2009 , ILE B:61 , TYR B:62 , THR B:66 , TYR B:73 , THR B:74 , TYR B:78BINDING SITE FOR RESIDUE CYC A1081
2AC2SOFTWARELEU B:60 , MEN B:71 , MET B:72 , ARG B:76 , ARG B:77 , CYS B:81 , ARG B:83 , ASP B:84 , TYR B:87 , ARG B:107 , LEU B:119 , PRO B:122 , THR B:126BINDING SITE FOR RESIDUE CYC B1081

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2VJT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2VJT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2VJT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2VJT)

(-) Exons   (0, 0)

(no "Exon" information available for 2VJT)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:160
 aligned with Q7NL80_GLOVI | Q7NL80 from UniProtKB/TrEMBL  Length:161

    Alignment length:160
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161
         Q7NL80_GLOVI     2 SVLTKAIVNADAEARYLSPGELDRIKSFVASGERRLRIAQTLTEARERIVKQAGDQLFQKRPDVVSPGGNAYGEKMTALCLRDLDYYLRLVTYGIVAGDVTPIEEIGIIGVKEMYNSLQTPIPAVAEGVRAMKNVATSLLSGDDAAEAGFYFDYLVGAMQ 161
               SCOP domains d2vjta_ A: automated matches                                                                                                                                     SCOP domains
               CATH domains 2vjtA00 A:2-161 Phycocyanins                                                                                                                                     CATH domains
               Pfam domains ---Phycobilisome-2vjtA01 A:5-161                                                                                                                                 Pfam domains
         Sec.struct. author hhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2vjt A   2 SVLTKAIVNADAEARYLSPGELDRIKSFVASGERRLRIAQTLTEARERIVKQAGDQLFQIRPDVVSPGGNAYGEKMTALCLRDLDYYLRLVTYGIVAGDVTPIEEIGIIGVKEMYNSLQTPIPAVAEGVRAMKNVATSLLSGDDAAEAGFYFDYLVGAMQ 161
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161

Chain B from PDB  Type:PROTEIN  Length:161
 aligned with Q7NL79_GLOVI | Q7NL79 from UniProtKB/TrEMBL  Length:161

    Alignment length:161
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160 
         Q7NL79_GLOVI     1 MQDAITAVINNYDVQGKYLDGAALDKLKAYFTTGAVRVRAAAVISSNATTIIKEAAAKALIYSDLTRPGGNMYTTRRYAACIRDMDYFLRYATYAMLAGDPSILDERVLNGLKETYNSLGVPIAATVGGIQAMKEVVGGLVGPDAAKEASIYFDYLSSGLS 161
               SCOP domains d2vjtb_ B: automated matches                                                                                                                                      SCOP domains
               CATH domains 2vjtB00 B:1-161 Phycocyanins                                                                                                                                      CATH domains
               Pfam domains -----Phycobilisome-2vjtB01 B:6-161                                                                                                                                Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhh..hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2vjt B   1 MQDAITAVINNYDVQGKYLDGAALDKLKAYFTTGAVRVRAAAVISSNATTIIKEAAAKALIYSDLTRPGGnMYTTRRYAACIRDMDYFLRYATYAMLAGDPSILDERVLNGLKETYNSLGVPIAATVGGIQAMKEVVGGLVGPDAAKEASIYFDYLSSGLS 161
                                    10        20        30        40        50        60        70|       80        90       100       110       120       130       140       150       160 
                                                                                                 71-MEN                                                                                      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: Globin (291)

(-) Gene Ontology  (4, 8)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q7NL80_GLOVI | Q7NL80)
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0030089    phycobilisome    Any of the granules, approximately 32 nm x 48 nm and consisting of highly aggregated phycobiliproteins, that are attached in arrays to the external face of a thylakoid membrane in algae of the phyla Cyanophyta and Rhodophyta, where they function as light-harvesting devices in photosynthesis. Excitation energy in the phycobilisome flows in the sequence: phycoerythrin, phycocyanin, allophycocyanin before passing to the antenna chlorophyll of photosystem II.

Chain B   (Q7NL79_GLOVI | Q7NL79)
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0015979    photosynthesis    The synthesis by organisms of organic chemical compounds, especially carbohydrates, from carbon dioxide (CO2) using energy obtained from light rather than from the oxidation of chemical compounds.
    GO:0018298    protein-chromophore linkage    The covalent or noncovalent attachment of a chromophore to a protein.
cellular component
    GO:0030089    phycobilisome    Any of the granules, approximately 32 nm x 48 nm and consisting of highly aggregated phycobiliproteins, that are attached in arrays to the external face of a thylakoid membrane in algae of the phyla Cyanophyta and Rhodophyta, where they function as light-harvesting devices in photosynthesis. Excitation energy in the phycobilisome flows in the sequence: phycoerythrin, phycocyanin, allophycocyanin before passing to the antenna chlorophyll of photosystem II.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CYC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MEN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2vjt)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2vjt
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q7NL79_GLOVI | Q7NL79
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q7NL80_GLOVI | Q7NL80
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q7NL79_GLOVI | Q7NL79
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q7NL80_GLOVI | Q7NL80
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2VJT)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2VJT)