2VID - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   SERINE PROTEASE SPLB FROM STAPHYLOCOCCUS AUREUS AT 1.8A RESOLUTION

Authors :   G. Dubin, J. Stec-Niemczyk, M. Kisielewska, K. Pustelny, G. M. Popowicz, M. Bista, T. Kantyka, K. T. Boulware, H. R. Stennicke, A. Czarna, M. Phopaisarn, P. S. Daugherty, I. B. Thogersen, J. J. Enghild, N. Thornberry, A. Dubin, J. Potempa

Date :   30 Nov 07 (Deposition) - 13 May 08 (Release) - 26 May 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: A  (1x)
Biol. Unit 3: B  (1x)

Keywords :   Protease, Serine Protease, Staphylococcus Aureus, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. Dubin, J. Stec-Niemczyk, M. Kisielewska, K. Pustelny, G. M. Popowicz, M. Bista, T. Kantyka, K. T. Boulware, H. R. Stennicke, A. Czarna, M. Phopaisarn, P. S. Daugherty, I. B. Thogersen, J. J. Enghild, N. Thornberry, A. Dubin, J. Potempa
Enzymatic Activity Of The Staphylococcus Aureus Splb Serine Protease Is Induced By Substrates Containing The Sequence Trp-Glu-Leu-Gln.
J. Mol. Biol. V. 379 343 2008
PubMed-ID: 18448121 | Reference-DOI: 10.1016/J.JMB.2008.03.059
(for further references see the PDB file header)

Molecule 1 - SERINE PROTEASE SPLB
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	BACILLUS SUBTILIS
	Expression System Plasmid	:	PWB980
	Expression System Strain	:	WB800
	Expression System Taxid	:	1423
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 37-240
	Organism Scientific	:	STAPHYLOCOCCUS AUREUS
	Organism Taxid	:	1280
	Strain	:	8325-4
	Synonym	:	SPLB SERINE PROTEASE

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:	A
Biological Unit 3 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2VID)

(no "Site" information available for 2VID)

(no "SS Bond" information available for 2VID)

Asymmetric Unit

No.	Residues
1	Phe A:13	-	Pro A:14
2	Phe B:13	-	Pro B:14

(no "SAP(SNP)/Variant" information available for 2VID)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	V8_HIS	PS00672	Serine proteases, V8 family, histidine active site.	SPLB_STAA8	61-75	2	A:25-39 B:25-39

Biological Unit 1 (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	V8_HIS	PS00672	Serine proteases, V8 family, histidine active site.	SPLB_STAA8	61-75	2	A:25-39 B:25-39

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	V8_HIS	PS00672	Serine proteases, V8 family, histidine active site.	SPLB_STAA8	61-75	1	A:25-39 -

Biological Unit 3 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	V8_HIS	PS00672	Serine proteases, V8 family, histidine active site.	SPLB_STAA8	61-75	1	- B:25-39

(no "Exon" information available for 2VID)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:199
 aligned with SPLB_STAA8 | Q2FXC3 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:204
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236    
           SPLB_STAA8    37 ENNVTKVKDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKNKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVKNDDNRNAYGVYFTPEIKKFIAENIDK 240
               SCOP domains d2vida_ A: automated matches                                                                                                                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeee.......hhh.eee....eeeeee..eeeehhhhhh......eeee..........eeeeeeeee.......eeeee..eeeeee..eeehhhhh.............eeeeee.....--....eeeeeeeeeee..eeee....hhhhh..eee.....eeeeeeee..---....eeee..hhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------V8_HIS         --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2vid A   1 ENNVTKVKDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPY--KYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDV---DNRNAYGVYFTPEIKKFIAENIDK 204
                                    10        20        30        40        50        60        70        80        90       100       110       120    |  130       140       150       160       170      |  -|      190       200    
                                                                                                                                                      125  |                                              177 181                       
                                                                                                                                                         128

Chain B from PDB  Type:PROTEIN  Length:200
 aligned with SPLB_STAA8 | Q2FXC3 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:204
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236    
           SPLB_STAA8    37 ENNVTKVKDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKNKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVKNDDNRNAYGVYFTPEIKKFIAENIDK 240
               SCOP domains d2vidb_ B: automated matches                                                                                                                                                                                 SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) -Trypsin-2vidB01 B:2-198                                                                                                                                                                              ------ Pfam domains (1)
           Pfam domains (2) -Trypsin-2vidB02 B:2-198                                                                                                                                                                              ------ Pfam domains (2)
         Sec.struct. author ..eeee.......hhh.eee....eeeeee..eeeehhhhhh......eeee..........eeeeeeeee.......eeeee..eeeeee..eee.hhh..............eeeeee...........eeeeeeeeeee..eeee....hhhhh..eee.....eeeeeeee...----..eeee..hhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------V8_HIS         --------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2vid B   1 ENNVTKVKDTNIFPYTGVVAFKSATGFVVGKNTILTNKHVSKNYKVGDRITAHPNSDKGNGGIYSIKKIINYPGKEDVSVIQVEERAIERGPKGFNFNDNVTPFKYAAGAKAGERIKVIGYPHPYKNKYVLYESTGPVMSVEGSSIVYSAHTESGNSGSPVLNSNNELVGIHFASDVK----RNAYGVYFTPEIKKFIAENIDK 204
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       | -  |    190       200    
                                                                                                                                                                                                           178  183

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Trypsin-like serine proteases (1752)

Superfamily: Trypsin-like serine proteases (1752)

Family: automated matches (71)

Protein domain: automated matches (71)

Staphylococcus aureus [TaxId: 1280] (2)

1a	d2vida_	A:
1b	d2vidb_	B:

(no "CATH Domain" information available for 2VID)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Peptidase_PA (797)

Family: Trypsin (679)

Staphylococcus aureus (strain NCTC 8325) (3)

1a	Trypsin-2vidB01	B:2-198
1b	Trypsin-2vidB02	B:2-198

Asymmetric Unit(hide GO term definitions)

Chain A,B (SPLB_STAA8 | Q2FXC3)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0004252	serine-type endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
	GO:0008236	serine-type peptidase activity	Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
biological process
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2vid)

	Sites
(no "Sites" information available for 2vid)

	Cis Peptide Bonds
		Phe A:13 - Pro A:14	[ RasMol ]
		Phe B:13 - Pro B:14	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2vid
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SPLB_STAA8 \| Q2FXC3
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SPLB_STAA8 \| Q2FXC3
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	SPLB_STAA8 \| Q2FXC3	:	4k1s 4k1t

(no "Related Entries Specified in the PDB File" available for 2VID)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File