2VGA - JenaLib

Title :   THE STRUCTURE OF VACCINIA VIRUS A41

Authors :   M. W. Bahar, J. C. Kenyon, M. M. Putz, N. G. A. Abrescia, J. E. Pease, E. L. W D. I. Stuart, G. L. Smith, J. M. Grimes

Date :   09 Nov 07 (Deposition) - 26 Feb 08 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym./Biol. Unit : A

Keywords :   Immunomodulator, Chemokine Binding Protein, Glycoprotein, Viral Protein, Early Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. W. Bahar, J. C. Kenyon, M. M. Putz, N. G. A. Abrescia, J. E. Pease, E. L. Wise, D. I. Stuart, G. L. Smith, J. M. Grimes
Structure And Function Of A41, A Vaccinia Virus Chemokine Binding Protein.
Plos Pathog. V. 4 E5 2008
PubMed-ID: 18208323 | Reference-DOI: 10.1371/JOURNAL.PPAT.0040005

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (4, 4)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:194
 aligned with A41_VACCW | P24766 from UniProtKB/Swiss-Prot  Length:219

    Alignment length:194
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215    
            A41_VACCW    26 CDSDNKEYMGIEVYVEATLDEPLRQTTCESKIHKYGASVSNGGLNISVDLLNCFLNFHTVGVYTNRDTVYAKFASLDPWTTEPINSMTHDDLVKLTEECIVDIYLKCEVDKTKDFMKTNGNRLKPRDFKTVPPSNVGSMIELQSDYCVNDVTTYVKIYDECGNIKQHSIPTLRDYFTTKNGQPRKILKKKFDNC 219
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeeeeeeee.........eeeee..eeeeee..eeeeeeee.......eeeeeee..eeeeeee...........eeehhhhhhhhhhheeeeeeee................hhh.eee.........eeee....eeeeeeeeeeee............eeeeee.......eee....ee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2vga A   6 CDSDNKEYMGIEVYVEATLDEPLRQTTCESKIHKYGASVSNGGLNISVDLLNCFLNFHTVGVYTNRDTVYAKFASLDPWTTEPINSMTHDDLVKLTEECIVDIYLKCEVDKTKDFMKTNGNRLKPRDFKTVPPSNVGSMIELQSDYCVNDVTTYVKIYDECGNIKQHSIPTLRDYFTTKNGQPRKILKKKFDNC 199
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (A41_VACCW | P24766)

biological process
	GO:0030683	evasion or tolerance by virus of host immune response	Any process, either active or passive, by which a virus avoids the effects of the host organism's immune response. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0039553	suppression by virus of host chemokine activity	Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of host chemokine activity.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2vga)

	Sites
(no "Sites" information available for 2vga)

	Cis Peptide Bonds
		Asp A:9 - Asn A:10	[ RasMol ]
		Glu A:87 - Pro A:88	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2vga
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	A41_VACCW \| P24766
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description