|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2VCD) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2VCD) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2VCD) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2VCD) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:137 aligned with MIP_LEGPH | Q5ZXE0 from UniProtKB/Swiss-Prot Length:233 Alignment length:137 106 116 126 136 146 156 166 176 186 196 206 216 226 MIP_LEGPH 97 FNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS 233 SCOP domains d2vcda_ A: automated matches SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains FKBP_N-2vcdA02 A:1-36 ----FKBP_C-2vcdA01 A:41-131 ------ Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----------------------------------------------FKBP_PPIASE PDB: A:48-134 UniProt: 144-230 --- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript 2vcd A 1 FNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKKSS 137 10 20 30 40 50 60 70 80 90 100 110 120 130
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2VCD) |
Pfam Domains (2, 2)
NMR Structure
|
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (MIP_LEGPH | Q5ZXE0)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|