|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2VAJ) |
Sites (0, 0)| (no "Site" information available for 2VAJ) |
SS Bonds (1, 1)
Asymmetric Unit
|
||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2VAJ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2VAJ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2VAJ) |
Exons (3, 3)
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:93 aligned with NCAM2_HUMAN | O15394 from UniProtKB/Swiss-Prot Length:837 Alignment length:93 30 40 50 60 70 80 90 100 110 NCAM2_HUMAN 21 LQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEKIISTQRVVVQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQ 113 SCOP domains --------------------------------------------------------------------------------------------- SCOP domains CATH domains 2vajA00 A:1-93 Immunoglobulins CATH domains Pfam domains I-set-2vajA01 A:1-91 -- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------- PROSITE Transcript 1 (1) Exon 1.6 PDB: A:1-24 --------------------------------------------------------------------1 Transcript 1 (1) Transcript 1 (2) -----------------------Exon 1.7 PDB: A:24-93 UniProt: 44-113 Transcript 1 (2) 2vaj A 1 LQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEKIISTQRVVVQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQ 93 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2VAJ) |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A (NCAM2_HUMAN | O15394)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|