Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF CORTICOSTEROID-BINDING GLOBULIN IN COMPLEX WITH CORTISOL
 
Authors :  M. A. Klieber, Y. A. Muller
Date :  21 Aug 07  (Deposition) - 04 Sep 07  (Release) - 02 Dec 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.93
Chains :  Asym./Biol. Unit :  A
Keywords :  Transport Protein, Cbg, Rcl, Serpin, Secreted, Transport, Glycoprotein, Lipid-Binding, Glucocorticoids, Steroid-Binding, Steroid Transporter, Corticosteroid-Binding Globulin Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. A. Klieber, C. Underhill, G. L. Hammond, Y. A. Muller
Corticosteroid-Binding Globulin: Structural Basis For Steroid Transport And Proteinase-Triggered Release
J. Biol. Chem. V. 282 29594 2007
PubMed-ID: 17644521  |  Reference-DOI: 10.1074/JBC.M705014200

(-) Compounds

Molecule 1 - CORTICOSTEROID-BINDING GLOBULIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPGEX-2T
    Expression System StrainK12 BL21(DE3)STAR
    Expression System Taxid469008
    FragmentRESIDUES 27-396
    MutationYES
    OrganLIVER
    Organism CommonRAT
    Organism ScientificRATTUS NORVEGICUS
    Organism Taxid10116
    SynonymCBG, TRANSCORTIN, SERPIN A6

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1HCY1Ligand/Ion(11ALPHA,14BETA)-11,17,21-TRIHYDROXYPREGN-4-ENE-3,20-DIONE

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREALA A:13 , PRO A:14 , GLN A:224 , PHE A:234 , ARG A:252 , ASP A:256 , LYS A:359 , TRP A:362 , HOH A:2096 , HOH A:2124 , HOH A:2174BINDING SITE FOR RESIDUE HCY A1375

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2V95)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2V95)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2V95)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SERPINPS00284 Serpins signature.CBG_RAT368-378  1A:346-356

(-) Exons   (4, 4)

Asymmetric/Biological Unit (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSRNOT000000125001ENSRNOE00000387882chr6:127921851-12792179953CBG_RAT-00--
1.2ENSRNOT000000125002ENSRNOE00000088455chr6:127919316-127918710607CBG_RAT1-1971971A:7-175 (gaps)169
1.3ENSRNOT000000125003ENSRNOE00000088496chr6:127916782-127916512271CBG_RAT197-287911A:175-26591
1.4ENSRNOT000000125004ENSRNOE00000088539chr6:127913696-127913552145CBG_RAT287-335491A:265-313 (gaps)49
1.5ENSRNOT000000125005ENSRNOE00000088575chr6:127912002-127911621382CBG_RAT336-396611A:314-374 (gaps)61

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:342
 aligned with CBG_RAT | P31211 from UniProtKB/Swiss-Prot  Length:396

    Alignment length:368
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388        
              CBG_RAT    29 NSHRGLAPTNVDFAFNLYQRLVALNPDKNTLISPVSISMALAMVSLGSAQTQSLQSLGFNLTETSEAEIHQSFQYLNYLLKQSDTGLEMNMGNAMFLLQKLKLKDSFLADVKQYYESEALAIDFEDWTKASQQINQHVKDKTQGKIEHVFSDLDSPASFILVNYIFLRGIWELPFSPENTREEDFYVNETSTVKVPMMVQSGSIGYFRDSVFPCQLIQMDYVGNGTAFFILPDQGQMDTVIAALSRDTIDRWGKLMTPRQVNLYIPKFSISDTYDLKDMLEDLNIKDLLTNQSDFSGNTKDVPLTLTMVHKAMLQLDEGNVLPNSTNGAPLHLRSEPLDIKFNKPFILLLFDKFTWSSLMMSQVVNPA 396
               SCOP domains d2v95a_ A: automated matches                                                                                                                                                                                                                                                                                                                                                     SCOP domains
               CATH domains 2v95A01 A:7-176,A:272-324 Antithrombin, subunit   I, domain 2                                                                                                             2v95A02 A:177-271,A:340-373 Alpha-1-antitrypsin, domain 1                                      2v95A01 A:7-176,A:272-324                            ----          -2v95A02 A:177-271,A:340-373       - CATH domains
               Pfam domains -------Serpin-2v95A01 A:14-373                                                                                                                                                                                                                                                                                                                                                 - Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhh....eeehhhhhhhhhhhhh...--hhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeee......hhhhhhhhhhhh..eeee....hhhhhhhhhhhhhhhhh.........--.....eeeeeeeeeee......hhhhheeeeee.....eeeeeeeeeeeeeeeeee....eeeeeee....eeeeeeee...hhhhhhhhhhhhhhhhhhhhheeeeeeeeee.eeeeeeee.hhh....hhhhhh..------------..eeeeeeeeeee......----------.....eeee....eeeeeee.....eeeeeee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SERPIN     ------------------ PROSITE
           Transcript 1 (1) Exon 1.2  PDB: A:7-175 (gaps) UniProt: 1-197 [INCOMPLETE]                                                                                                                -----------------------------------------------------------------------------------------Exon 1.4  PDB: A:265-313 (gaps) UniProt: 287-335 Exon 1.5  PDB: A:314-374 (gaps) UniProt: 336-396              Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.3  PDB: A:175-265 UniProt: 197-287                                                  ------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2v95 A   7 NSHRGLAPTNVDFAFNLYQRLVALNPDKNTLISPVSISMALAMVSLGS--TQSLQSLGFNLTETSEAEIHQSFQYLNYLLKQSDTGLEMNMGNAMFLLQKLKLKDSFLADVKQYYESEALAIDFEDWTKASQQINQHVKDKTQGKIEHVFS--DSPASFILVNYIFLRGIWELPFSPENTREEDFYVNETSTVKVPMMVQSGSIGYFRDSVFPCQLIQMDYVGNGTAFFILPDQGQMDTVIAALSRDTIDRWGKLMTPRQVNLYIPKFSMSDTYDLKDVLEDLNIKDLLTN------------LTLTMVHKAMLQLDEGNVL----------LRSEPLDIKFNKPFILLLFDKFTWSSLMMSQVVNPA 374
                                    16        26        36        46       | -|       66        76        86        96       106       116       126       136       146       156|  |   166       176       186       196       206       216       226       236       246       256       266       276       286       296|        -   |   316       326 |       -  |    346       356       366        
                                                                          54 57                                                                                                 157  |                                                                                                                                      297          310               328        339                                   
                                                                                                                                                                                   160                                                                                                                                                                                                                      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit

(-) Gene Ontology  (12, 12)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (CBG_RAT | P31211)
molecular function
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
    GO:0004867    serine-type endopeptidase inhibitor activity    Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
    GO:0005496    steroid binding    Interacting selectively and non-covalently with a steroid, any of a large group of substances that have in common a ring system based on 1,2-cyclopentanoperhydrophenanthrene.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
    GO:0008211    glucocorticoid metabolic process    The chemical reactions and pathways involving glucocorticoids, hormonal C21 corticosteroids synthesized from cholesterol. Glucocorticoids act primarily on carbohydrate and protein metabolism, and have anti-inflammatory effects.
    GO:0010951    negative regulation of endopeptidase activity    Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005575    cellular_component    The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HCY  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2v95)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2v95
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CBG_RAT | P31211
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CBG_RAT | P31211
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2V95)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2V95)