|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2V72) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2V72) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2V72) |
Exons (0, 0)| (no "Exon" information available for 2V72) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:137 aligned with Q8XMY5_CLOPE | Q8XMY5 from UniProtKB/TrEMBL Length:1173 Alignment length:137 53 63 73 83 93 103 113 123 133 143 153 163 173 Q8XMY5_CLOPE 44 IETAIPQSEMTASATSEEGQDPASSAIDGNINTMWHTKWNGSDALPQSLSVNLGKARKVSSIAITPRTSGNNGFITKYEIHAINNGVETLVAEGTWEENNLVKTVTFDSPIDAEEIKITAIQGVGGFASIAELNVYE 180 SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----F5_F8_type_C-2v72A02 A:6-134 Sial Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript 2v72 A 2 IETAIPQSEMTASATSEEGQDPASSAIDGNINTMWHTKWNGSDALPQSLSVNLGKARKVSSIAITPRTSGNNGFITKYEIHAINNGVETLVAEGTWEENNLVKTVTFDSPIDAEEIKITAIQGVGGFASIAELNVYE 138 11 21 31 41 51 61 71 81 91 101 111 121 131
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2V72) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2V72) |
Pfam Domains (2, 2)
Asymmetric/Biological Unit
|
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q8XMY5_CLOPE | Q8XMY5)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|