2V6V - JenaLib

Title :   THE STRUCTURE OF THE BEM1P PX DOMAIN

Authors :   R. V. Stahelin, D. Karathanassis, D. Murray, R. L. Williams, W. Cho

Date :   21 Jul 07 (Deposition) - 31 Jul 07 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.50

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Homotypic Fusion, Regulator, Pi3P, 3-Kinase, Px Domain, Sh3 Domain, Cytoskeleton, Cell Polarity, Phosphorylation, Phosphoinositide (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. V. Stahelin, D. Karathanassis, D. Murray, R. L. Williams, W. Cho
Structural And Membrane Binding Analysis Of The Phox Homology Domain Of Bem1P: Basis Of Phosphatidylinositol 4-Phosphate Specificity.
J. Biol. Chem. V. 282 25737 2007
PubMed-ID: 17581820 | Reference-DOI: 10.1074/JBC.M702861200

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 5)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (1, 2)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:135
 aligned with BEM1_YEAST | P29366 from UniProtKB/Swiss-Prot  Length:551

    Alignment length:135
                                   285       295       305       315       325       335       345       355       365       375       385       395       405     
           BEM1_YEAST   276 KLVDGELLVKASVESFGLEDEKYWFLVCCELSNGKTRQLKRYYQDFYDLQVQLLDAFPAEAGKLRDAGGQWSKRIMPYIPGPVPYVTNSITKKRKEDLNIYVADLVNLPDYISRSEMVHSLFVVLNNGFDREFER 410
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeeeeeeee..eeeeeeeeee....eeeeeehhhhhhhhhhhhhhhh.............................hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhh.........eee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --PX  PDB: A:278-404 UniProt: 278-404                                                                                            ------ PROSITE
               Transcript 1 Exon 1.1  PDB: A:276-410 UniProt: 1-551 [INCOMPLETE]                                                                                    Transcript 1
                 2v6v A 276 KLVDGELLVKASVESFGLEDEKYWFLVCCELSNGKTRQLKRYYQDFYDLQVQLLDAFPAEAGKLRDAGGQWSKRImPYIPGPVPYVTNSITKKRKEDLNIYVADLVNLPDYISRSEmVHSLFVVLNNGFDREFER 410
                                   285       295       305       315       325       335       345     | 355       365       375       385      |395       405     
                                                                                                     351-MSE                                  392-MSE

Chain B from PDB  Type:PROTEIN  Length:135
 aligned with BEM1_YEAST | P29366 from UniProtKB/Swiss-Prot  Length:551

    Alignment length:136
                                   284       294       304       314       324       334       344       354       364       374       384       394       404      
           BEM1_YEAST   275 AKLVDGELLVKASVESFGLEDEKYWFLVCCELSNGKTRQLKRYYQDFYDLQVQLLDAFPAEAGKLRDAGGQWSKRIMPYIPGPVPYVTNSITKKRKEDLNIYVADLVNLPDYISRSEMVHSLFVVLNNGFDREFER 410
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ------PX-2v6vB01 B:281-400                                                                                                    ---------- Pfam domains (1)
           Pfam domains (2) ------PX-2v6vB02 B:281-400                                                                                                    ---------- Pfam domains (2)
         Sec.struct. author ........eeeeeeeeeeee..eeeeeeeeee....eeeeeehhhhhhhhhhhhhhhh.........-...................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---PX  PDB: B:278-404 UniProt: 278-404                                                                                            ------ PROSITE
               Transcript 1 Exon 1.1  PDB: B:275-410 (gaps) UniProt: 1-551 [INCOMPLETE]                                                                              Transcript 1
                 2v6v B 275 AKLVDGELLVKASVESFGLEDEKYWFLVCCELSNGKTRQLKRYYQDFYDLQVQLLDAFPAEAGKLRD-GGQWSKRImPYIPGPVPYVTNSITKKRKEDLNIYVADLVNLPDYISRSEmVHSLFVVLNNGFDREFER 410
                                   284       294       304       314       324       334      |344      |354       364       374       384       394       404      
                                                                                            341 |     351-MSE                                  392-MSE              
                                                                                              343

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (1, 2)

Gene Ontology (12, 12)

Asymmetric Unit(hide GO term definitions)

Chain A,B (BEM1_YEAST | P29366)

molecular function
	GO:0035091	phosphatidylinositol binding	Interacting selectively and non-covalently with any inositol-containing glycerophospholipid, i.e. phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
	GO:0032266	phosphatidylinositol-3-phosphate binding	Interacting selectively and non-covalently with phosphatidylinositol-3-phosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3' position.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032947	protein complex scaffold activity	A structural molecule activity that provides a physical support for the assembly of a multiprotein complex. The scaffold may or may not be part of the final complex.
biological process
	GO:0000902	cell morphogenesis	The developmental process in which the size or shape of a cell is generated and organized.
	GO:0000753	cell morphogenesis involved in conjugation with cellular fusion	The change in form (cell shape and size) that occurs during sexual reproduction in order to facilitate direct contact between the compatible mating types in organisms that undergo conjugation cellular fusion.
cellular component
	GO:0005935	cellular bud neck	The constriction between the mother cell and daughter cell (bud) in an organism that reproduces by budding.
	GO:0005934	cellular bud tip	The end of a cellular bud distal to the site of attachment to the mother cell.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0000131	incipient cellular bud site	The portion of the budding yeast plasma membrane where a daughter cell will emerge. The yeast marks this spot with bud-site selection proteins before bud emergence occurs. Actin is polarized to this spot just prior to and during bud emergence.
	GO:0030427	site of polarized growth	Any part of a cell where non-isotropic growth takes place.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		DTT	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2v6v)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2v6v
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BEM1_YEAST \| P29366
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description