Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  KINESIN 16B PHOX-HOMOLOGY DOMAIN (KIF16B)
 
Authors :  M. I. Wilson, R. L. Williams, W. Cho, W. Hong, N. R. Blatner
Date :  21 May 07  (Deposition) - 31 Jul 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.20
Chains :  Asym./Biol. Unit :  A
Keywords :  Plus-End Kinesin Complex, Transport Protein, Phosphatidylinositol 3-Phosphate Binding, Nucleotide-Binding, Alternative Splicing, Motor Protein, Ubl Conjugation, Endosome Transport, Plus-End-Directed Microtubule Motor Activity, Microtubule, Coiled Coil, Atp-Binding, Polymorphism (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  N. R. Blatner, M. I. Wilson, C. Lei, W. Hong, D. Murray, R. L. Williams, W. Cho
The Structural Basis Of Novel Endosome Anchoring Activity Of Kif16B Kinesin.
Embo J. V. 26 3709 2007
PubMed-ID: 17641687  |  Reference-DOI: 10.1038/SJ.EMBOJ.7601800

(-) Compounds

Molecule 1 - KINESIN-LIKE MOTOR PROTEIN C20ORF23
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainB834(DE3)PLYSS
    Expression System Taxid562
    FragmentPHOX-HOMOLOGY DOMAIN, RESIDUES 1179-1312
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymKIF16B KINESIN-3 MOTOR PROTEIN, SORTING NEXIN-23

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1MSE2Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1PIPnot definedARG A:1220 , TYR A:1221 , ARG A:1225 , ARG A:1260
2STKnot definedLEU A:1248 , PHE A:1249

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2V14)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2V14)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2V14)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1PXPS50195 PX domain profile.KI16B_HUMAN1182-1296  1A:1182-1296

(-) Exons   (4, 4)

Asymmetric/Biological Unit (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000003549811ENSE00002141744chr20:16554078-16553874205KI16B_HUMAN1-16160--
1.2ENST000003549812ENSE00001660648chr20:16509085-1650901670KI16B_HUMAN16-39240--
1.3ENST000003549813ENSE00001711412chr20:16506850-16506737114KI16B_HUMAN40-77380--
1.4ENST000003549814ENSE00001792314chr20:16496309-16496193117KI16B_HUMAN78-116390--
1.5ENST000003549815ENSE00001734539chr20:16493568-1649347198KI16B_HUMAN117-149330--
1.6ENST000003549816ENSE00001746117chr20:16492172-16492063110KI16B_HUMAN149-186380--
1.7ENST000003549817ENSE00001633238chr20:16488745-16488603143KI16B_HUMAN186-233480--
1.8ENST000003549818ENSE00001672630chr20:16486835-16486667169KI16B_HUMAN234-290570--
1.9ENST000003549819ENSE00001626389chr20:16486498-16486367132KI16B_HUMAN290-334450--
1.10ENST0000035498110ENSE00001771396chr20:16485192-16485017176KI16B_HUMAN334-392590--
1.11ENST0000035498111ENSE00001773786chr20:16478323-1647825866KI16B_HUMAN393-414220--
1.12ENST0000035498112ENSE00001695661chr20:16474995-1647493660KI16B_HUMAN415-434200--
1.13ENST0000035498113ENSE00001641833chr20:16410627-16410508120KI16B_HUMAN435-474400--
1.14ENST0000035498114ENSE00001736699chr20:16409649-1640959852KI16B_HUMAN475-492180--
1.15ENST0000035498115ENSE00001678469chr20:16407886-16407749138KI16B_HUMAN492-538470--
1.16ENST0000035498116ENSE00001742883chr20:16387101-1638701983KI16B_HUMAN538-565280--
1.17aENST0000035498117aENSE00001692663chr20:16385546-1638545889KI16B_HUMAN566-595300--
1.19ENST0000035498119ENSE00001696249chr20:16362392-1636233954KI16B_HUMAN595-613190--
1.20cENST0000035498120cENSE00002179857chr20:16360808-163594501359KI16B_HUMAN613-10664540--
1.21ENST0000035498121ENSE00001757983chr20:16355054-16354902153KI16B_HUMAN1066-1117520--
1.22ENST0000035498122ENSE00001714600chr20:16352406-1635231097KI16B_HUMAN1117-1149330--
1.23ENST0000035498123ENSE00001752698chr20:16351281-1635123151KI16B_HUMAN1150-1166170--
1.25ENST0000035498125ENSE00000659811chr20:16337097-16336975123KI16B_HUMAN1167-1207411A:1179-120729
1.26ENST0000035498126ENSE00000859157chr20:16316660-1631657190KI16B_HUMAN1208-1237301A:1208-123730
1.27ENST0000035498127ENSE00000859156chr20:16293063-1629298084KI16B_HUMAN1238-1265281A:1238-126528
1.28bENST0000035498128bENSE00001926747chr20:16254056-162527491308KI16B_HUMAN1266-1317521A:1266-131247

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:134
 aligned with KI16B_HUMAN | Q96L93 from UniProtKB/Swiss-Prot  Length:1317

    Alignment length:134
                                  1188      1198      1208      1218      1228      1238      1248      1258      1268      1278      1288      1298      1308    
         KI16B_HUMAN   1179 DLKDPIKISIPRYVLCGQGKDAHFEFEVKITVLDETWTVFRRYSRFREMHKTLKLKYAELAALEFPPKKLFGNKDERVIAERRSHLEKYLRDFFSVMLQSATSPLHINKVGLTLSKHTICEFSPFFKKGVFDYS 1312
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---PX-2v14A01 A:1182-1281                                                                              ------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeeeeee......eeeeeeeeee..eeeeeeehhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---PX  PDB: A:1182-1296 UniProt: 1182-1296                                                                            ---------------- PROSITE
               Transcript 1 Exon 1.25  PDB: A:1179-1207  Exon 1.26  PDB: A:1208-1237   Exon 1.27  PDB: A:1238-1265 Exon 1.28b  PDB: A:1266-1312 UniProt: 1266-1317 Transcript 1
                2v14 A 1179 DLKDPIKISIPRYVLCGQGKDAHFEFEVKITVLDETWTVFRRYSRFREmHKTLKLKYAELAALEFPPKKLFGNKDERVIAERRSHLEKYLRDFFSVmLQSATSPLHINKVGLTLSKHTICEFSPFFKKGVFDYS 1312
                                  1188      1198      1208      1218      1228      1238      1248      1258      1268      1278      1288      1298      1308    
                                                                         1227-MSE                                        1275-MSE                                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2V14)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2V14)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Family: PX (17)
1aPX-2v14A01A:1182-1281

(-) Gene Ontology  (32, 32)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (KI16B_HUMAN | Q96L93)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0008574    ATP-dependent microtubule motor activity, plus-end-directed    Catalysis of movement along a microtubule toward the plus end, coupled to the hydrolysis of ATP.
    GO:0017137    Rab GTPase binding    Interacting selectively and non-covalently with Rab protein, any member of the Rab subfamily of the Ras superfamily of monomeric GTPases.
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0008017    microtubule binding    Interacting selectively and non-covalently with microtubules, filaments composed of tubulin monomers.
    GO:0003777    microtubule motor activity    Catalysis of movement along a microtubule, coupled to the hydrolysis of a nucleoside triphosphate (usually ATP).
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0035091    phosphatidylinositol binding    Interacting selectively and non-covalently with any inositol-containing glycerophospholipid, i.e. phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
    GO:0005547    phosphatidylinositol-3,4,5-trisphosphate binding    Interacting selectively and non-covalently with phosphatidylinositol-3,4,5-trisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3', 4' and 5' positions.
    GO:0043325    phosphatidylinositol-3,4-bisphosphate binding    Interacting selectively and non-covalently with phosphatidylinositol-3,4-bisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3' and 4' positions.
    GO:0080025    phosphatidylinositol-3,5-bisphosphate binding    Interacting selectively and non-covalently with phosphatidylinositol-3,5-bisphosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3' and 5' positions.
    GO:0032266    phosphatidylinositol-3-phosphate binding    Interacting selectively and non-covalently with phosphatidylinositol-3-phosphate, a derivative of phosphatidylinositol in which the inositol ring is phosphorylated at the 3' position.
biological process
    GO:0006895    Golgi to endosome transport    The directed movement of substances from the Golgi to early sorting endosomes. Clathrin vesicles transport substances from the trans-Golgi to endosomes.
    GO:0030705    cytoskeleton-dependent intracellular transport    The directed movement of substances along cytoskeletal fibers such as microfilaments or microtubules within a cell.
    GO:0045022    early endosome to late endosome transport    The directed movement of substances, in membrane-bounded vesicles, from the early sorting endosomes to the late sorting endosomes; transport occurs along microtubules and can be experimentally blocked with microtubule-depolymerizing drugs.
    GO:0007492    endoderm development    The process whose specific outcome is the progression of the endoderm over time, from its formation to the mature structure. The endoderm is the innermost germ layer that develops into the gastrointestinal tract, the lungs and associated tissues.
    GO:0007173    epidermal growth factor receptor signaling pathway    A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0008543    fibroblast growth factor receptor signaling pathway    The series of molecular signals generated as a consequence of a fibroblast growth factor receptor binding to one of its physiological ligands.
    GO:0001704    formation of primary germ layer    The formation of the ectoderm, mesoderm and endoderm during gastrulation.
    GO:0007018    microtubule-based movement    A microtubule-based process that results in the movement of organelles, other microtubules, or other cellular components. Examples include motor-driven movement along microtubules and movement driven by polymerization or depolymerization of microtubules.
    GO:0032801    receptor catabolic process    The chemical reactions and pathways resulting in the breakdown of a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0001919    regulation of receptor recycling    Any process that modulates the frequency, rate, or extent of receptor recycling.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005856    cytoskeleton    Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005769    early endosome    A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
    GO:0031901    early endosome membrane    The lipid bilayer surrounding an early endosome.
    GO:0005768    endosome    A vacuole to which materials ingested by endocytosis are delivered.
    GO:0005871    kinesin complex    Any complex that includes a dimer of molecules from the kinesin superfamily, a group of related proteins that contain an extended region of predicted alpha-helical coiled coil in the main chain that likely produces dimerization. The native complexes of several kinesin family members have also been shown to contain additional peptides, often designated light chains as all of the noncatalytic subunits that are currently known are smaller than the chain that contains the motor unit. Kinesin complexes generally possess a force-generating enzymatic activity, or motor, which converts the free energy of the gamma phosphate bond of ATP into mechanical work.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005874    microtubule    Any of the long, generally straight, hollow tubes of internal diameter 12-15 nm and external diameter 24 nm found in a wide variety of eukaryotic cells; each consists (usually) of 13 protofilaments of polymeric tubulin, staggered in such a manner that the tubulin monomers are arranged in a helical pattern on the microtubular surface, and with the alpha/beta axes of the tubulin subunits parallel to the long axis of the tubule; exist in equilibrium with pool of tubulin monomers and can be rapidly assembled or disassembled in response to physiological stimuli; concerned with force generation, e.g. in the spindle.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    PIP  [ RasMol ]  +environment [ RasMol ]
    STK  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2v14)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2v14
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KI16B_HUMAN | Q96L93
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KI16B_HUMAN | Q96L93
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2V14)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2V14)