2UYY - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   STRUCTURE OF THE CYTOKINE-LIKE NUCLEAR FACTOR N-PAC

Authors :   J. Tickle, E. S. Pilka, G. Bunkoczi, G. Berridge, C. Smee, K. L. Kavanagh V. Hozjan, F. H. Niesen, E. Papagrigoriou, A. C. W. Pike, A. Turnbull, C. H. Arrowsmith, A. Edwards, M. Sundstrom, J. Weigelt, F. Von Delft, U. Oppermann

Date :   20 Apr 07 (Deposition) - 03 Jul 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym./Biol. Unit : A,B,C,D

Keywords :   Long-Chain Dehydrogenase, Cytokine (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Tickle, E. S. Pilka, G. Bunkoczi, G. Berridge, C. Smee, K. L. Kavanagh, V. Hozjan, F. H. Niesen, E. Papagrigoriou, A. C. W. Pike A. Turnbull, C. H. Arrowsmith, A. Edwards, M. Sundstrom, J. Weigelt, F. Von Delft, U. Oppermann
The Structure Of The Cytokine-Like Nuclear Factor N-Pac
To Be Published
PubMed: search

Molecule 1 - N-PAC PROTEIN
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Cell Line	:	DE3-R3
	Expression System Plasmid	:	PNIC28-BSA4
	Expression System Strain	:	BL21
	Expression System Taxid	:	511693
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 192-484
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CYTOKINE-LIKE NUCLEAR FACTOR N-PAC

		1	2	3	4
Asymmetric/Biological Unit	:	A	B	C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (2, 6)

No.	Name	Count	Type	Full Name
1	K	4	Ligand/Ion	POTASSIUM ION
2	NA7	2	Ligand/Ion	[(2R,3R,4R,5R)-5-(6-AMINO-9H-PURIN-9-YL)-3-HYDROXY-4-(PHOSPHONOOXY)TETRAHYDROFURAN-2-YL]METHYL [(2R,3S,4S)-3,4-DIHYDROXYTETRAHYDROFURAN-2-YL]METHYL DIHYDROGENDIPHOSPHATE

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:397 , GLN A:418 , ALA A:419 , GLY A:421 , HOH A:2039	BINDING SITE FOR RESIDUE K A1554
2	AC2	SOFTWARE	GLY B:397 , GLN B:418 , ALA B:419 , GLY B:421 , HOH B:2033	BINDING SITE FOR RESIDUE K B1554
3	AC3	SOFTWARE	GLY C:397 , GLN C:418 , ALA C:419 , GLY C:421 , HOH C:2035 , HOH C:2045	BINDING SITE FOR RESIDUE K C1554
4	AC4	SOFTWARE	GLY D:397 , GLN D:418 , ALA D:419 , GLY D:421 , HOH D:2044	BINDING SITE FOR RESIDUE K D1554
5	AC5	SOFTWARE	GLY A:276 , LEU A:277 , MET A:278 , ASN A:297 , ARG A:298 , THR A:299 , LYS A:302 , CYS A:330 , VAL A:331 , SER A:332 , ALA A:336 , ASP A:339 , THR A:362 , TYR A:499 , TYR A:502 , LYS A:505 , HOH A:2089 , HOH A:2090 , HOH A:2091	BINDING SITE FOR RESIDUE NA7 A1555
6	AC6	SOFTWARE	LEU D:275 , GLY D:276 , LEU D:277 , MET D:278 , ASN D:297 , ARG D:298 , THR D:299 , CYS D:330 , VAL D:331 , SER D:332 , ALA D:336 , ASP D:339 , THR D:362 , PHE D:498 , TYR D:499 , TYR D:502 , LYS D:505 , HOH D:2100 , HOH D:2101 , HOH D:2102	BINDING SITE FOR RESIDUE NA7 D1555

(no "SS Bond" information available for 2UYY)

(no "Cis Peptide Bond" information available for 2UYY)

Asymmetric/Biological Unit (2, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_037404	H	459	Q	GLYR1_HUMAN	Polymorphism	2085329	A/B/C/D	Q	459	Q
2	UniProt	VAR_037405	Y	531	C	GLYR1_HUMAN	Polymorphism	17703111	A/B/C/D	Y	531	C

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2UYY)

Asymmetric/Biological Unit (8, 32)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000321919	1a	ENSE00000944218	chr16:4897343-4897229	115	GLYR1_HUMAN	1-13	13	0	-	-
1.2	ENST00000321919	2	ENSE00001145253	chr16:4896211-4896175	37	GLYR1_HUMAN	13-25	13	0	-	-
1.3	ENST00000321919	3	ENSE00000944205	chr16:4895154-4895075	80	GLYR1_HUMAN	26-52	27	0	-	-
1.4	ENST00000321919	4	ENSE00000944206	chr16:4882913-4882775	139	GLYR1_HUMAN	52-98	47	0	-	-
1.5	ENST00000321919	5	ENSE00000944207	chr16:4882222-4881980	243	GLYR1_HUMAN	99-179	81	0	-	-
1.6	ENST00000321919	6	ENSE00000944208	chr16:4873908-4873822	87	GLYR1_HUMAN	180-208	29	0	-	-
1.7	ENST00000321919	7	ENSE00000944209	chr16:4872932-4872876	57	GLYR1_HUMAN	209-227	19	0	-	-
1.8	ENST00000321919	8	ENSE00000944220	chr16:4871598-4871548	51	GLYR1_HUMAN	228-244	17	0	-	-
1.9	ENST00000321919	9	ENSE00000944210	chr16:4871454-4871381	74	GLYR1_HUMAN	245-269	25	4	A:262-269 B:262-269 C:262-269 D:263-269	8 8 8 7
1.10	ENST00000321919	10	ENSE00000944211	chr16:4867698-4867599	100	GLYR1_HUMAN	269-302	34	4	A:269-302 B:269-302 C:269-302 D:269-302	34 34 34 34
1.11a	ENST00000321919	11a	ENSE00001192716	chr16:4864648-4864538	111	GLYR1_HUMAN	303-339	37	4	A:303-339 B:303-339 C:303-339 D:303-339	37 37 37 37
1.12	ENST00000321919	12	ENSE00000944213	chr16:4863839-4863738	102	GLYR1_HUMAN	340-373	34	4	A:340-373 B:340-373 C:340-373 D:340-373	34 34 34 34
1.13	ENST00000321919	13	ENSE00000944214	chr16:4862249-4862087	163	GLYR1_HUMAN	374-428	55	4	A:374-428 B:374-428 C:374-428 D:374-428	55 55 55 55
1.14	ENST00000321919	14	ENSE00000944215	chr16:4861803-4861624	180	GLYR1_HUMAN	428-488	61	4	A:428-488 B:428-488 C:428-488 D:428-488	61 61 61 61
1.15	ENST00000321919	15	ENSE00000944216	chr16:4861295-4861171	125	GLYR1_HUMAN	488-529	42	4	A:488-529 B:488-529 C:488-529 D:488-529	42 42 42 42
1.16b	ENST00000321919	16b	ENSE00000944217	chr16:4855311-4853204	2108	GLYR1_HUMAN	530-553	24	4	A:530-553 B:530-553 C:530-553 D:530-553	24 24 24 24

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:292
 aligned with GLYR1_HUMAN | Q49A26 from UniProtKB/Swiss-Prot  Length:553

    Alignment length:292
                                   271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551  
          GLYR1_HUMAN   262 SITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAHVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH 553
               SCOP domains d2uyya1 A:262-429 automated matches                                                                                                                                     d2uyya2 A:430-553 automated matches                                                                                          SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee..hhhhhhhhhhhhhh...eeee..hhhhhhhhhhh..ee..hhhhhhhhh.eeee...hhhhhhhhhhh..hhhhhh....eeee....hhhhhhhhhhhhhhh..eeee..ee.hhhhhhhh.eeeeeeehhhhhhhhhhhhhhheeeeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh......hhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Q-----------------------------------------------------------------------C---------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) -------Exon 1.10  PDB: A:269-302         Exon 1.11a  PDB: A:303-339           Exon 1.12  PDB: A:340-373         Exon 1.13  PDB: A:374-428 UniProt: 374-428             -----------------------------------------------------------Exon 1.15  PDB: A:488-529 UniProt: 488-529Exon 1.16b               Transcript 1 (1)
           Transcript 1 (2) Exon 1.9--------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.14  PDB: A:428-488 UniProt: 428-488                   ----------------------------------------------------------------- Transcript 1 (2)
                 2uyy A 262 SITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH 553
                                   271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551

Chain B from PDB  Type:PROTEIN  Length:292
 aligned with GLYR1_HUMAN | Q49A26 from UniProtKB/Swiss-Prot  Length:553

    Alignment length:292
                                   271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551  
          GLYR1_HUMAN   262 SITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAHVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH 553
               SCOP domains d2uyyb1 B:262-429 automated matches                                                                                                                                     d2uyyb2 B:430-553 automated matches                                                                                          SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee....hhhhhhhhhhhh...eeee..hhhhhhhhh....ee..hhhhhhhhh.eeee...hhhhhhhhhhh..hhhhhh....eeee....hhhhhhhhhhhhhhh..eeee..ee.hhhhhhhh.eeeeeeehhhhhhhhhhhhhhheeeeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh......hhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Q-----------------------------------------------------------------------C---------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) -------Exon 1.10  PDB: B:269-302         Exon 1.11a  PDB: B:303-339           Exon 1.12  PDB: B:340-373         Exon 1.13  PDB: B:374-428 UniProt: 374-428             -----------------------------------------------------------Exon 1.15  PDB: B:488-529 UniProt: 488-529Exon 1.16b               Transcript 1 (1)
           Transcript 1 (2) Exon 1.9--------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.14  PDB: B:428-488 UniProt: 428-488                   ----------------------------------------------------------------- Transcript 1 (2)
                 2uyy B 262 SITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH 553
                                   271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551

Chain C from PDB  Type:PROTEIN  Length:292
 aligned with GLYR1_HUMAN | Q49A26 from UniProtKB/Swiss-Prot  Length:553

    Alignment length:292
                                   271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551  
          GLYR1_HUMAN   262 SITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAHVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH 553
               SCOP domains d2uyyc1 C:262-429 automated matches                                                                                                                                     d2uyyc2 C:430-553 automated matches                                                                                          SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeee..hhhhhhhhhhhhhh...eeee..hhhhhhhhhhh..ee..hhhhhhhhh.eeee...hhhhhhhhhhh..hhhhhh....eeee....hhhhhhhhhhhhhhh..eeee..ee.hhhhhhh..eeeeeeehhhhhhhhhhhhhhheeeeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh......hhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Q-----------------------------------------------------------------------C---------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) -------Exon 1.10  PDB: C:269-302         Exon 1.11a  PDB: C:303-339           Exon 1.12  PDB: C:340-373         Exon 1.13  PDB: C:374-428 UniProt: 374-428             -----------------------------------------------------------Exon 1.15  PDB: C:488-529 UniProt: 488-529Exon 1.16b               Transcript 1 (1)
           Transcript 1 (2) Exon 1.9--------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.14  PDB: C:428-488 UniProt: 428-488                   ----------------------------------------------------------------- Transcript 1 (2)
                 2uyy C 262 SITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH 553
                                   271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551

Chain D from PDB  Type:PROTEIN  Length:291
 aligned with GLYR1_HUMAN | Q49A26 from UniProtKB/Swiss-Prot  Length:553

    Alignment length:291
                                   272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552 
          GLYR1_HUMAN   263 ITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAHVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH 553
               SCOP domains d2uyyd1 D:263-429 automated matches                                                                                                                                    d2uyyd2 D:430-553 automated matches                                                                                          SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ----NAD_binding_2-2uyyD01 D:267-429                                                                                                                                    ---------------------------------------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ----NAD_binding_2-2uyyD02 D:267-429                                                                                                                                    ---------------------------------------------------------------------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) ----NAD_binding_2-2uyyD03 D:267-429                                                                                                                                    ---------------------------------------------------------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ----NAD_binding_2-2uyyD04 D:267-429                                                                                                                                    ---------------------------------------------------------------------------------------------------------------------------- Pfam domains (4)
         Sec.struct. author ......eeeee..hhhhhhhhhhhhhh..eeeee..hhhhhhhhhhh..ee..hhhhhhhhh.eeee...hhhhhhhhhhh..hhhhhh....eeee....hhhhhhhhhhhhhhh..eeee..ee.hhhhhhhh.eeeeeeehhhhhhhhhhhhhhheeeeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh......hhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Q-----------------------------------------------------------------------C---------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) ------Exon 1.10  PDB: D:269-302         Exon 1.11a  PDB: D:303-339           Exon 1.12  PDB: D:340-373         Exon 1.13  PDB: D:374-428 UniProt: 374-428             -----------------------------------------------------------Exon 1.15  PDB: D:488-529 UniProt: 488-529Exon 1.16b               Transcript 1 (1)
           Transcript 1 (2) 1.9    --------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.14  PDB: D:428-488 UniProt: 428-488                   ----------------------------------------------------------------- Transcript 1 (2)
                 2uyy D 263 ITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH 553
                                   272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: 6-phosphogluconate dehydrogenase C-terminal domain-like (119)

Superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like (119)

Family: automated matches (50)

Protein domain: automated matches (50)

Human (Homo sapiens) [TaxId: 9606] (13)

1a	d2uyya2	A:430-553
1b	d2uyyb2	B:430-553
1c	d2uyyc2	C:430-553
1d	d2uyyd2	D:430-553

Class: Alpha and beta proteins (a/b) (23833)

Fold: NAD(P)-binding Rossmann-fold domains (1604)

Superfamily: NAD(P)-binding Rossmann-fold domains (1604)

Family: automated matches (447)

Protein domain: automated matches (447)

Human (Homo sapiens) [TaxId: 9606] (32)

2a	d2uyya1	A:262-429
2b	d2uyyb1	B:262-429
2c	d2uyyc1	C:262-429
2d	d2uyyd1	D:263-429

(no "CATH Domain" information available for 2UYY)

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: NADP_Rossmann (1239)

Family: NAD_binding_2 (15)

Homo sapiens (Human) (2)

1a	NAD_binding_2-2uyyD01	D:267-429
1b	NAD_binding_2-2uyyD02	D:267-429
1c	NAD_binding_2-2uyyD03	D:267-429
1d	NAD_binding_2-2uyyD04	D:267-429

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B,C,D (GLYR1_HUMAN | Q49A26)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0051287	NAD binding	Interacting selectively and non-covalently with nicotinamide adenine dinucleotide, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NAD+, or the reduced form, NADH.
	GO:0035064	methylated histone binding	Interacting selectively and non-covalently with a histone in which a residue has been modified by methylation. Histones are any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0004616	phosphogluconate dehydrogenase (decarboxylating) activity	Catalysis of the reaction: 6-phospho-D-gluconate + NADP+ = D-ribulose 5-phosphate + CO2 + NADPH + H+.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0005794	Golgi apparatus	A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		K	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NA7	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2uyy)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2uyy
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GLYR1_HUMAN \| Q49A26
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GLYR1_HUMAN \| Q49A26
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GLYR1_HUMAN \| Q49A26	:	4gur 4gus 4gut 4guu 4hsu

(no "Related Entries Specified in the PDB File" available for 2UYY)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 8)

PROSITE Motifs (0, 0)

Exons (8, 32)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 8)

CATH Domains (0, 0)

Pfam Domains (1, 4)

Gene Ontology (11, 11)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File